[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54892.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:119 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   45->63 PF02198 * SAM_PNT 1.4e-05 31.6 19/83  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54892.1 GT:GENE BAD54892.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 36200..36559 GB:FROM 36200 GB:TO 36559 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54892.1 LENGTH 119 SQ:AASEQ MSRNRNRRPRPAGAPEPQDFKPKSPAEREAKGGDTVEVKFRGMTFEVAADPAKWSYWQVTQWLPSNNFANACIGLLGPGQTAKIHMRYPDLTSVGALELFSELFMEIAKATGFGNTGNS GT:EXON 1|1-119:0| SEG 3->11|rnrnrrprp| HM:PFM:NREP 1 HM:PFM:REP 45->63|PF02198|1.4e-05|31.6|19/83|SAM_PNT| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-34, 115-119| PSIPRED ccccccccccccccccccccccccccccccccccEEEEEEccEEEEEEcccccccEEEEEEEcccccccccEEEEccccccEEEEEEccccccccHHHHHHHHHHHHHHHccccccccc //