[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54900.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  5/175   --->[See Alignment]
d.118.1
:270 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->168 1iyaA PDBj 1e-09 36.1 %
:RPS:PDB   22->159 2ar3A PDBj 1e-18 20.0 %
:RPS:SCOP  1->179 1j3gA  d.118.1.1 * 2e-21 28.7 %
:HMM:SCOP  8->179 1j3gA_ d.118.1.1 * 2e-36 28.6 %
:RPS:PFM   83->159 PF01510 * Amidase_2 2e-05 43.3 %
:HMM:PFM   28->160 PF01510 * Amidase_2 1.6e-16 25.2 123/130  
:BLT:SWISS 30->168 AMPD_ENTCL 1e-09 35.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54900.1 GT:GENE BAD54900.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 46884..47696 GB:FROM 46884 GB:TO 47696 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54900.1 LENGTH 270 SQ:AASEQ MPDPVWLPDVLRAAGLEVREYPGWRDRGHGDFGEIWGVIAHHTGSNPPSNNPGHIAQHPQLGLASQLHLSRDGVYTVCGVGIAWHAGNGSYPGLPTNDANRVTIGIEAENNGTEGWSPRQYTAYVKGVAAILRKLGKGAGNVIGHKEWAGAAQGKWDPGGMDMNRFRADVQKAIGDPTSVRGEGTVWGEMFENFKKTKVSYATAIYYIDQKVNEVWEQVGRGWKQLGTNAKGEPLTLVDAVAEHKAHTAAELADIKASLSAVLEKLEGRS GT:EXON 1|1-270:0| BL:SWS:NREP 1 BL:SWS:REP 30->168|AMPD_ENTCL|1e-09|35.3|133/187| BL:PDB:NREP 1 BL:PDB:REP 30->168|1iyaA|1e-09|36.1|133/187| RP:PDB:NREP 1 RP:PDB:REP 22->159|2ar3A|1e-18|20.0|130/157| RP:PFM:NREP 1 RP:PFM:REP 83->159|PF01510|2e-05|43.3|67/129|Amidase_2| HM:PFM:NREP 1 HM:PFM:REP 28->160|PF01510|1.6e-16|25.2|123/130|Amidase_2| GO:PFM:NREP 2 GO:PFM GO:0008745|"GO:N-acetylmuramoyl-L-alanine amidase activity"|PF01510|IPR002502| GO:PFM GO:0009253|"GO:peptidoglycan catabolic process"|PF01510|IPR002502| RP:SCP:NREP 1 RP:SCP:REP 1->179|1j3gA|2e-21|28.7|167/187|d.118.1.1| HM:SCP:REP 8->179|1j3gA_|2e-36|28.6|168/187|d.118.1.1|1/1|N-acetylmuramoyl-L-alanine amidase-like| OP:NHOMO 26 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- ------1------11--11-11---211111-11111-----------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------1-----------------------------------------------------------------1------------1-1-------------------------------------1----------------------------------------- STR:NPRED 232 STR:RPRED 85.9 SQ:SECSTR ##ccccccccccTTTTTcHHHGGGHHHHccccccccEEEEEEccccccHHHHHHHHHHHHccccccccEEEccccEEEccccccccccTTcHHcccTTTHHHEEEEEEccTTTccHHHHHHHHHHHHHHHHHHHHTccGGGEEEcHHHHcccHHHHHTTHHHHHHHTTccccccccHHHHHHHTcccTTccccHHHHHHHHHHHTccccTTcHHHHHHHHHHHHHcTTcccccc#################################### DISOP:02AL 269-270| PSIPRED cccccccHHHHHHccccEEEcccHHHccccccccccEEEEEEEcccccHHHHHHHHccccccccEEEEEccccEEEEEccccEEEccccccccccccccccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHccccHHHEEEccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //