[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54901.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:71 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->56 PF04246 * RseC_MucC 1.4e-05 30.0 40/135  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54901.1 GT:GENE BAD54901.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 47693..47908 GB:FROM 47693 GB:TO 47908 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54901.1 LENGTH 71 SQ:AASEQ MNAITKALNSEPILTRMTPVLGLLAIYLIGKYVTDADLANLLLGIATIVLGGGAMVTARAKVRPLAKEQIE GT:EXON 1|1-71:0| TM:NTM 2 TM:REGION 11->33| TM:REGION 37->59| HM:PFM:NREP 1 HM:PFM:REP 17->56|PF04246|1.4e-05|30.0|40/135|RseC_MucC| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 6-7, 67-71| PSIPRED ccHHHHHcccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHEEHHHHHcHHHHHccc //