[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54902.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:149 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->119 PF06772 * LtrA 0.00099 23.7 93/354  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54902.1 GT:GENE BAD54902.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 47905..48354 GB:FROM 47905 GB:TO 48354 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54902.1 LENGTH 149 SQ:AASEQ MRRIRRWVDAETVRLPQAIVYCAYIVAGVQSLALGAPPNAVAQAMGHEVALMWTALIIACPTLTLVGLWQRRRAFSLWLQLAGDSGVTCASAAYVVAVLQATWSERATFAAWSAAALAICGALITWRDARRIRQVSKRIQAFEEGCARE GT:EXON 1|1-149:0| TM:NTM 4 TM:REGION 13->35| TM:REGION 49->70| TM:REGION 84->105| TM:REGION 107->129| SEG 105->122|eratfaawsaaalaicga| HM:PFM:NREP 1 HM:PFM:REP 25->119|PF06772|0.00099|23.7|93/354|LtrA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 148-149| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //