[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54903.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:115 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   50->105 PF05791 * Bacillus_HBL 4e-04 32.1 %
:HMM:PFM   41->83 PF05531 * NPV_P10 9.5e-05 30.2 43/75  
:HMM:PFM   6->41 PF06808 * DctM 0.00045 25.0 36/416  
:BLT:SWISS 30->80 GCC2_HUMAN 6e-04 29.4 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54903.1 GT:GENE BAD54903.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 48347..48694 GB:FROM 48347 GB:TO 48694 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54903.1 LENGTH 115 SQ:AASEQ MNDIASLLTATGVGSALTALVAGIFGWRLRSANYAQIVSDMSRQVAEDLRKDNRELEQKVDTLQGSVETLRLRVIELTEALRGAIHRLDEYGHDTDPLRAVLQGRINGTGGHGHG GT:EXON 1|1-115:0| BL:SWS:NREP 1 BL:SWS:REP 30->80|GCC2_HUMAN|6e-04|29.4|51/100| COIL:NAA 48 COIL:NSEG 1 COIL:REGION 38->85| SEG 108->114|gtgghgh| RP:PFM:NREP 1 RP:PFM:REP 50->105|PF05791|4e-04|32.1|56/182|Bacillus_HBL| HM:PFM:NREP 2 HM:PFM:REP 41->83|PF05531|9.5e-05|30.2|43/75|NPV_P10| HM:PFM:REP 6->41|PF06808|0.00045|25.0|36/416|DctM| GO:PFM:NREP 2 GO:PFM GO:0009405|"GO:pathogenesis"|PF05791|IPR008414| GO:PFM GO:0016020|"GO:membrane"|PF05791|IPR008414| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 47-55, 107-115| PSIPRED ccHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccc //