[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54906.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:172 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   79->135 2dhhA PDBj 6e-05 14.0 %
:RPS:PFM   83->140 PF05592 * Bac_rhamnosid 2e-04 44.6 %
:HMM:PFM   34->105 PF10099 * RskA 5e-05 19.4 72/175  
:BLT:SWISS 88->124 CKI2_SCHPO 4e-04 45.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54906.1 GT:GENE BAD54906.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(50599..51117) GB:FROM 50599 GB:TO 51117 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54906.1 LENGTH 172 SQ:AASEQ MARHSRRPWTHSAHAATVMRDQDRRPKGDCMTTQPPAAPPPGRRRTNAIILGVVGAVLAVVLLIVIIGAVAGGDEDVPVYTVTRDQQTFTATVDFDDEADLRAVFDDVREKNSDLPDGGYDVMINCSTGGTAEVPARLAWGRFAIGNLGAAQTGLEKGDSELKLMDGVRCPA GT:EXON 1|1-172:0| BL:SWS:NREP 1 BL:SWS:REP 88->124|CKI2_SCHPO|4e-04|45.9|37/100| TM:NTM 1 TM:REGION 48->70| SEG 35->41|ppaappp| SEG 48->73|aiilgvvgavlavvlliviigavagg| RP:PDB:NREP 1 RP:PDB:REP 79->135|2dhhA|6e-05|14.0|57/1022| RP:PFM:NREP 1 RP:PFM:REP 83->140|PF05592|2e-04|44.6|56/503|Bac_rhamnosid| HM:PFM:NREP 1 HM:PFM:REP 34->105|PF10099|5e-05|19.4|72/175|RskA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 57 STR:RPRED 33.1 SQ:SECSTR ##############################################################################ccEEEETTccEEccEEccTTccHHHHHHHHHHHGGGccHHHHHHcccEEEccccccE##################################### DISOP:02AL 1-6, 27-28, 34-40| PSIPRED cccccccccccccHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccEEEEEEccccccHHHHHHHHHHHHcccccccccEEEEEccccccccccHHHHccEEEccccccHHHccccccccEEEEccccccc //