[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54907.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:62 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   36->58 PF07216 * LcrG 0.001 34.8 23/93  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54907.1 GT:GENE BAD54907.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(51118..51306) GB:FROM 51118 GB:TO 51306 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54907.1 LENGTH 62 SQ:AASEQ MSWIRDYCEQRSFILDEPHAAGLVKLHATCDPPCPRQRAAQAYLDEIRRREDDQRNRPTAIS GT:EXON 1|1-62:0| HM:PFM:NREP 1 HM:PFM:REP 36->58|PF07216|0.001|34.8|23/93|LcrG| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 48-62| PSIPRED ccHHHHHHHHccccccccccccEEEEcccccccccHHHHHHHHHHHHHHccccccccccccc //