Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54908.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:97 amino acids
:HMM:PFM   1->28 PF09851 * DUF2078 0.00096 28.6 28/73  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54908.1 GT:GENE BAD54908.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(51303..51596) GB:FROM 51303 GB:TO 51596 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54908.1 LENGTH 97 SQ:AASEQ MMMAVLLGSIAIAGAVWALLHLLDPPVRPEQPWSAADVIARVTGECHPEPSTLTAELAHAVLQARIECDIERCGAKWAAYWFLVDQGRIVPGRQVAR GT:EXON 1|1-97:0| TM:NTM 1 TM:REGION 3->25| HM:PFM:NREP 1 HM:PFM:REP 1->28|PF09851|0.00096|28.6|28/73|DUF2078| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 95-97| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHEEEEccccccccccccc //