[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54910.1
DDBJ      :             putative DNA-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:202 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->40 1sq8A PDBj 7e-05 50.0 %
:RPS:PDB   5->66 2axvB PDBj 4e-14 14.8 %
:RPS:SCOP  5->66 2auwA1  a.35.1.10 * 8e-15 11.3 %
:HMM:SCOP  1->75 1y9qA1 a.35.1.8 * 4.2e-13 33.3 %
:RPS:PFM   9->63 PF01381 * HTH_3 1e-07 40.0 %
:HMM:PFM   9->62 PF01381 * HTH_3 5.4e-15 38.9 54/55  
:HMM:PFM   91->142 PF00753 * Lactamase_B 0.00029 23.8 42/194  
:BLT:SWISS 1->64 Y474_MYCTU 9e-08 35.9 %
:BLT:SWISS 75->151 MTNA_RHIME 3e-04 37.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54910.1 GT:GENE BAD54910.1 GT:PRODUCT putative DNA-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 51972..52580 GB:FROM 51972 GB:TO 52580 GB:DIRECTION + GB:PRODUCT putative DNA-binding protein GB:PROTEIN_ID BAD54910.1 LENGTH 202 SQ:AASEQ MAADIGEIIRDRREALGLGQRELSERVGVTERQIGRYESGAQEPAASTCRLLARALHLSFAQLFGEVPIGLDLSGQWYAAWETSRGGTPVIDRHGLVVSHAGDHVVCTADGDYLWSGDLRIVDGSLMGTYRSTEAARQFRGSLYFTLADDTTAAVGRWTGLWADGLLGSGWGAIARDEDRAGRLLDTLINHNGPVTTWPQEG GT:EXON 1|1-202:0| BL:SWS:NREP 2 BL:SWS:REP 1->64|Y474_MYCTU|9e-08|35.9|64/140| BL:SWS:REP 75->151|MTNA_RHIME|3e-04|37.0|73/364| BL:PDB:NREP 1 BL:PDB:REP 5->40|1sq8A|7e-05|50.0|36/64| RP:PDB:NREP 1 RP:PDB:REP 5->66|2axvB|4e-14|14.8|61/303| RP:PFM:NREP 1 RP:PFM:REP 9->63|PF01381|1e-07|40.0|55/55|HTH_3| HM:PFM:NREP 2 HM:PFM:REP 9->62|PF01381|5.4e-15|38.9|54/55|HTH_3| HM:PFM:REP 91->142|PF00753|0.00029|23.8|42/194|Lactamase_B| GO:PFM:NREP 1 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| RP:SCP:NREP 1 RP:SCP:REP 5->66|2auwA1|8e-15|11.3|62/67|a.35.1.10| HM:SCP:REP 1->75|1y9qA1|4.2e-13|33.3|75/0|a.35.1.8|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1----1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 176 STR:RPRED 87.1 SQ:SECSTR cHHHHHHHHHHHHHHHTccHHHHHTTHTccHHHHHHHHTTcccccHHHHHHHHHHHTccHHHHHHHHHHccccTTcccccGGGccEEcccTTccTTEEEEEccccTTcTTcEEEEEEEccccGGGccccccccEEEEEEEccEEEEEccTTccEEEEE#EEEEccccccccccccTT######################### DISOP:02AL 196-197, 199-202| PSIPRED ccHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHcccccccccccccccHHHcccccccccccccEEEEEEccEEEEEccccEEEEccEEEEEEEEEEEEccHHHHHHccccEEEEEccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccccccccc //