[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54914.1
DDBJ      :             putative ABC transporter membrane protein
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  103/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:285 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   28->237 PF01061 * ABC2_membrane 1e-15 26.5 %
:HMM:PFM   28->235 PF01061 * ABC2_membrane 3.1e-31 24.0 196/208  
:BLT:SWISS 24->241 DRRB_STRPE 5e-32 35.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54914.1 GT:GENE BAD54914.1 GT:PRODUCT putative ABC transporter membrane protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 55698..56555 GB:FROM 55698 GB:TO 56555 GB:DIRECTION + GB:PRODUCT putative ABC transporter membrane protein GB:PROTEIN_ID BAD54914.1 LENGTH 285 SQ:AASEQ MTAGTTTFDTPADPGLGSRLGMVVSDTITVTKRNVIKIKRVPDVLIFSTLSPIMFVLLFAYVFGTAIEVPGLEGGYREFLIAGIFAQTVVFGSSFTGASLAEDMQKGIIDRFRSLPMAPSAVLVGRTVSDVVINLVSLVVMSVTGLLVGWRIRGSFLDAVLAYVLLLLFAYAVSWIMAVVGLLVRSPEVFNNASFMVMFPLTFLANTFVPIEELPTVLRVFAEWNPVSALTLATRELFGNTGALGPQSDAWSMRHPIATTLIWVVVILVVFVPLALRQYKRAVSR GT:EXON 1|1-285:0| BL:SWS:NREP 1 BL:SWS:REP 24->241|DRRB_STRPE|5e-32|35.2|216/283| TM:NTM 6 TM:REGION 46->68| TM:REGION 79->101| TM:REGION 121->143| TM:REGION 158->180| TM:REGION 189->211| TM:REGION 258->279| SEG 156->173|fldavlayvllllfayav| SEG 261->276|liwvvvilvvfvplal| RP:PFM:NREP 1 RP:PFM:REP 28->237|PF01061|1e-15|26.5|204/208|ABC2_membrane| HM:PFM:NREP 1 HM:PFM:REP 28->235|PF01061|3.1e-31|24.0|196/208|ABC2_membrane| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF01061|IPR013525| OP:NHOMO 215 OP:NHOMOORG 128 OP:PATTERN --1----1111111112------1----------1---1-111-1-1-2-433-1---------1--- --126----------11----1--1-------11118575152626-2-1--121--1--521-252679--------------1-----------1----------------------------11-------------------1-1-11--------1--11--1-1-1-------1-1-------1-1--11111111-11111111----111-11----111111-3----------------------1--------11----1------11---------------------------------------------2---------------11---------------1-----1------------------------------------------------------1------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------1111-----------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 283-285| PSIPRED cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccHHHccHHHHHHHHHccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //