[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54915.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:77 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   28->47 PF09596 * MamL-1 8.4e-05 45.0 20/61  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54915.1 GT:GENE BAD54915.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 56623..56856 GB:FROM 56623 GB:TO 56856 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54915.1 LENGTH 77 SQ:AASEQ MRGGSGAGSGGNGRLLRTSQAAPPARPRRVAAMSRLRERADTCRRPKVIRPLSHSRGNHAVTAGNRHPRPGWIAWRR GT:EXON 1|1-77:0| SEG 3->13|ggsgagsggng| SEG 21->32|aapparprrvaa| HM:PFM:NREP 1 HM:PFM:REP 28->47|PF09596|8.4e-05|45.0|20/61|MamL-1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-15| PSIPRED ccccccccccccccEEEccccccccccHHHHHHHHHHHHHHHHcccccccccccccccEEEEcccccccccEEcccc //