[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54917.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:153 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   64->147 PF10756 * DUF2581 5e-17 33.3 72/73  
:HMM:PFM   12->71 PF12484 * PE_PPE_C 0.00038 43.1 58/83  
:BLT:SWISS 62->142 Y010_MYCTU 3e-08 44.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54917.1 GT:GENE BAD54917.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(57836..58297) GB:FROM 57836 GB:TO 58297 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54917.1 LENGTH 153 SQ:AASEQ MNPEPSASPSLSWATPAPALVAVGLGGAVLAVAAFFAGDAPSRLLVGLAAAGLLGLAVLGARQRPRLEVRPGSPPVLVVRTFLGPTEYRPEQIIRARIVSYRRLGRRSPMLEIDVRHHDGERLLIFGRWDLGTNPQDVFDALVVHRLAFLPKD GT:EXON 1|1-153:0| BL:SWS:NREP 1 BL:SWS:REP 62->142|Y010_MYCTU|3e-08|44.0|75/100| TM:NTM 2 TM:REGION 16->38| TM:REGION 40->61| SEG 16->38|papalvavglggavlavaaffag| SEG 44->61|llvglaaagllglavlga| HM:PFM:NREP 2 HM:PFM:REP 64->147|PF10756|5e-17|33.3|72/73|DUF2581| HM:PFM:REP 12->71|PF12484|0.00038|43.1|58/83|PE_PPE_C| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------------------------1------1---1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11| PSIPRED cccccccccccccccccccEEEccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccEEEcccccEEEEEEEccccEEEccccEEEEEEEEEHHHcccccEEEEEEEEccccEEEEEEEccccccHHHHHHHHHHHHHHHcccc //