[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54918.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->87 PF06781 * UPF0233 8e-18 55.8 %
:HMM:PFM   1->87 PF06781 * UPF0233 5e-42 64.4 87/87  
:BLT:SWISS 1->87 Y020_MYCSK 1e-21 52.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54918.1 GT:GENE BAD54918.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(58400..58663) GB:FROM 58400 GB:TO 58663 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54918.1 LENGTH 87 SQ:AASEQ MPKSKVRKKTDYTINPASRTPVKVKAGPSPVWYVAIMLGFMLAGLLWLLVYYLAAEQISWMNDLNAWNFLIGFGLMVVGLIMTMRWR GT:EXON 1|1-87:0| BL:SWS:NREP 1 BL:SWS:REP 1->87|Y020_MYCSK|1e-21|52.9|87/94| TM:NTM 2 TM:REGION 34->56| TM:REGION 63->84| SEG 37->55|mlgfmlagllwllvyylaa| RP:PFM:NREP 1 RP:PFM:REP 2->87|PF06781|8e-18|55.8|86/86|UPF0233| HM:PFM:NREP 1 HM:PFM:REP 1->87|PF06781|5e-42|64.4|87/87|UPF0233| OP:NHOMO 31 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- -----------11-11112-11111111111111111111------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9| PSIPRED ccccccccccccEEcccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHccHHHHccHHHHHHHHHHHHHHHHHHHccc //