[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54921.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  132/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.37.1
:156 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->140 1xkfB PDBj 3e-23 39.8 %
:RPS:PDB   19->148 3ctuB PDBj 4e-11 8.6 %
:RPS:SCOP  18->138 2o16A3  d.37.1.1 * 2e-18 21.8 %
:HMM:SCOP  19->82 1y5hA2 d.37.1.1 * 2.4e-12 32.8 %
:HMM:SCOP  85->150 1y5hA2 d.37.1.1 * 3.6e-11 30.3 %
:HMM:PFM   21->72 PF00571 * CBS 2.9e-13 30.8 52/57  
:HMM:PFM   94->141 PF00571 * CBS 1.9e-14 35.4 48/57  
:BLT:SWISS 18->144 YHCV_BACSU 6e-11 26.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54921.1 GT:GENE BAD54921.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(60578..61048) GB:FROM 60578 GB:TO 61048 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54921.1 LENGTH 156 SQ:AASEQ MRMGSAPPEPTRTRRQLMTTARDIMKPGAQWISKQDTVERAAQLMADLGVGSLVVADENERMCGIVTDRDIVVKCVAHGANPATTPAAELCEATPRWVAADADVEEVLDAMENHRVKRMPVIENKRLVGMISEADLARHLDDNQLSEFVTAVYGRP GT:EXON 1|1-156:0| BL:SWS:NREP 1 BL:SWS:REP 18->144|YHCV_BACSU|6e-11|26.4|125/140| SEG 98->112|vaadadveevldame| BL:PDB:NREP 1 BL:PDB:REP 18->140|1xkfB|3e-23|39.8|123/123| RP:PDB:NREP 1 RP:PDB:REP 19->148|3ctuB|4e-11|8.6|128/146| HM:PFM:NREP 2 HM:PFM:REP 21->72|PF00571|2.9e-13|30.8|52/57|CBS| HM:PFM:REP 94->141|PF00571|1.9e-14|35.4|48/57|CBS| RP:SCP:NREP 1 RP:SCP:REP 18->138|2o16A3|2e-18|21.8|119/130|d.37.1.1| HM:SCP:REP 19->82|1y5hA2|2.4e-12|32.8|64/0|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 85->150|1y5hA2|3.6e-11|30.3|66/0|d.37.1.1|2/2|CBS-domain| OP:NHOMO 190 OP:NHOMOORG 138 OP:PATTERN ---1-1----------------------------------------------------1--------1 ----1------------11-1-----11111-1---1----113--------11-------1--1213-11----------------------------------1-----------------------------------------------------------------------------11-------2-111111-1-1-11---122-211-122----------1--------------------------------------------------------------------------------------------11111111111-1-1---1----11-----1----1--11-------------111-----1-1------------------------1-----2---1-----2---11--------1211-----------------2-------------------------------1---------3443432111144122222-1341-1-------1-112-2113--1----------------1-1-1------------------------1--11---------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------1-21----11-1---------------------------11------------------------------------------------------------------------- ----11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 88.5 SQ:SECSTR ###########cccccEcTTHHHHEEEGGcccEETTccHHHHHHHHTTccccEEEEcTTccEEEEEcHHHHEHHHHHTccHHHHTccGGGcccccccccTTccHHHHHHHHHHccEHEEEEcTTccEEEEEEHHHHHHHHHHHHTTccH####### DISOP:02AL 1-18, 154-156| PSIPRED cccccccccHHHHHccHHHHHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEEcccEEEEEEEHHHHHHHHHHcccccccccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEEccEEEEEEEHHHHHHHHHHHHHHHHHHHHcccc //