[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54923.1
DDBJ      :             putative serine/threonine protein kinase
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  529/915 : Eukaryota  198/199 : Viruses  2/175   --->[See Alignment]
d.144.1
:507 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->238 3f69B PDBj 5e-55 46.4 %
:RPS:PDB   10->260 3dbsA PDBj 6e-37 11.2 %
:RPS:SCOP  8->276 1mruA  d.144.1.7 * 5e-41 43.5 %
:HMM:SCOP  7->487 1omwA3 d.144.1.7 * 1.1e-70 27.7 %
:RPS:PFM   14->259 PF00069 * Pkinase 2e-32 36.4 %
:HMM:PFM   12->260 PF00069 * Pkinase 1.1e-52 34.3 242/260  
:BLT:SWISS 5->278 PKNA_MYCLE e-116 73.4 %
:PROS 136->148|PS00108|PROTEIN_KINASE_ST
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54923.1 GT:GENE BAD54923.1 GT:PRODUCT putative serine/threonine protein kinase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(62995..64518) GB:FROM 62995 GB:TO 64518 GB:DIRECTION - GB:PRODUCT putative serine/threonine protein kinase GB:PROTEIN_ID BAD54923.1 LENGTH 507 SQ:AASEQ MLTNGAMIADRYRLQRLIATGGMGQVWEALDTRLNRRVAVKVLKAEFSADPTFRQRFRTEAQTTAQLNHSGIAGIYDYGETYDPSAGETSYLVMELVQGEPLNAVLSRLGKLSVNQGLDMLEQTGRALEVAHAAGVVHRDVKPGNILVTPTGQVKITDFGIAKAVDASPVTKTGMVMGTAQYIAPEQAVGEDATAASDVYSLGVVGYEALAGKRPFSGDGAITVAMKHVRETPPPMPADVPANVRELIEITMGKDPQLRYASGGEFADAVAAVRAGHRPPPPIGAAAAGPIAEDATHVLPPGPTVVLPAGQGEGPTVRYSRPAAAAVGAGAAPTAAGAPATMMNEHGGATAVPPQGGKKPWTTTQKVLAGLSAAAVLLAGAVLWLLFGGDTDPEPDRPPVTTTIAPQPPLPPTTQPTTTRFVPPPPPQTSEPEPTTTQPPTTTPEPTTAAPTTTPEPTTTARPTRTQRPTTSRTLFPTFDLPFPEDSGARGPSGTVSAPTTSPQGQQ GT:EXON 1|1-507:0| BL:SWS:NREP 1 BL:SWS:REP 5->278|PKNA_MYCLE|e-116|73.4|274/437| PROS 136->148|PS00108|PROTEIN_KINASE_ST|PDOC00100| TM:NTM 1 TM:REGION 367->388| SEG 279->292|ppppigaaaagpia| SEG 322->341|paaaavgagaaptaagapat| SEG 367->389|vlaglsaaavllagavlwllfgg| SEG 401->474|tttiapqpplppttqptttrfvpppppqtsepeptttqpptttpepttaaptttpeptttarptrtqrpttsrt| BL:PDB:NREP 1 BL:PDB:REP 3->238|3f69B|5e-55|46.4|233/282| RP:PDB:NREP 1 RP:PDB:REP 10->260|3dbsA|6e-37|11.2|250/841| RP:PFM:NREP 1 RP:PFM:REP 14->259|PF00069|2e-32|36.4|239/256|Pkinase| HM:PFM:NREP 1 HM:PFM:REP 12->260|PF00069|1.1e-52|34.3|242/260|Pkinase| GO:PFM:NREP 3 GO:PFM GO:0004672|"GO:protein kinase activity"|PF00069|IPR017442| GO:PFM GO:0005524|"GO:ATP binding"|PF00069|IPR017442| GO:PFM GO:0006468|"GO:protein amino acid phosphorylation"|PF00069|IPR017442| RP:SCP:NREP 1 RP:SCP:REP 8->276|1mruA|5e-41|43.5|255/269|d.144.1.7| HM:SCP:REP 7->487|1omwA3|1.1e-70|27.7|358/364|d.144.1.7|1/1|Protein kinase-like (PK-like)| OP:NHOMO 34059 OP:NHOMOORG 747 OP:PATTERN -------------1---111111-1--B---1-----------31-13-------1-6---1--1--- 4U*4h5444445446AABB-BB44ODBBBBBCBDDEK9cS4oSv5673554577A435227793OFHTTQL55555662225811-----2--1--4-----------11222222222222222--1-----2--CBBNO---W2pFNOAAH8944------869EokqZ------------56644112112222222222222222111211222111111122223232122121-1112221111211111111111111111111-11111111111111111111111111111111111111111111111111121122111111112121111111113111242112122111211111---T-u1---------4311---31111------------1111-3-1-2-----211-12---31-6--313131--12222222211---6--------------------------------11-------2411112-2222--332222132123121-1---665333233621152331------------3A51A573111-11111----2----1HHKG**-5-----------------------11----2217513-2-1---2211112-211-23------2---------------------2-----------1--------1-------------------2-2---------------------------4---------11C12----------------------12115333421234111222------------2222-----12232--2-4--111----115-112222---------------1-111-111---211111--1-1---------55 TROS***3*******kohdirupnnommlfkGgnojimgjghkrlkenttmlrudmqjmqnrpsoollKisupopv*fuymsrrpq**-**zoy**ykrpojj***G*************************f******************************************T****ywv******j**s****** --------------------------------------------------------------------------------------------------------------------------------------------------------------------------4--1- STR:NPRED 276 STR:RPRED 54.4 SQ:SECSTR ccTTcTccTEEEEEEEccTTccccccEEEcccHHHHHHHHHHHHHHHHHHTTTcccccccccEEEEETTEEEEEccTTEEEHHHHHTccccTTccccTTHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHHTcccccGGGEEEETTccEEEcccccccccccccHHHHHHTTccHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHcccccTTTTTHHHHHHTTTTTccHHHHHHHHHHHHHHHHHHTTHHHHTccTTTTHTTcTGGcc####################################################################################################################################################################################################################################### DISOP:02AL 1-4, 281-507| PSIPRED ccccccEEcccEEEEEEEEccccEEEEEEEEcccccEEEEEEEcHHHHccHHHHHHHHHHHHHHHHcccccEEEEEEEEcccccccccEEEEEEEccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccEEEEcccccEEEcccccEEEEEHHHHHccccccccccEEEEEcHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHccHHHccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //