[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54927.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  95/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.26.1
:155 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   60->148 2kfuA PDBj 4e-11 39.8 %
:RPS:PDB   60->154 2affA PDBj 1e-17 14.7 %
:RPS:SCOP  58->154 1r21A  b.26.1.2 * 6e-18 14.4 %
:HMM:SCOP  19->154 1g3gA_ b.26.1.2 * 2.4e-22 30.1 %
:RPS:PFM   85->132 PF00498 * FHA 3e-07 50.0 %
:HMM:PFM   83->142 PF00498 * FHA 2.4e-17 38.3 60/68  
:BLT:SWISS 59->148 ODHI_CORJK 1e-11 38.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54927.1 GT:GENE BAD54927.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(69023..69490) GB:FROM 69023 GB:TO 69490 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54927.1 LENGTH 155 SQ:AASEQ MQGLILQLTRAGFLLLLWLFVWAVLRTLRSDIYAASGIRIQPRAARGSAVLPSLRRGQKGAKYLVVTQGSLAGTRITLGTQPVLIGRADDSTLVLTDDYASTRHARLSPRGDDWYVEDLGSTNGTYLDRAKVTTAVRVPLGTPVRVGKTVIELRS GT:EXON 1|1-155:0| BL:SWS:NREP 1 BL:SWS:REP 59->148|ODHI_CORJK|1e-11|38.2|89/144| TM:NTM 1 TM:REGION 4->26| SEG 8->26|ltragfllllwlfvwavlr| BL:PDB:NREP 1 BL:PDB:REP 60->148|2kfuA|4e-11|39.8|88/161| RP:PDB:NREP 1 RP:PDB:REP 60->154|2affA|1e-17|14.7|95/98| RP:PFM:NREP 1 RP:PFM:REP 85->132|PF00498|3e-07|50.0|48/68|FHA| HM:PFM:NREP 1 HM:PFM:REP 83->142|PF00498|2.4e-17|38.3|60/68|FHA| RP:SCP:NREP 1 RP:SCP:REP 58->154|1r21A|6e-18|14.4|97/100|b.26.1.2| HM:SCP:REP 19->154|1g3gA_|2.4e-22|30.1|136/164|b.26.1.2|1/1|SMAD/FHA domain| OP:NHOMO 132 OP:NHOMOORG 95 OP:PATTERN -------------------------------------------------------------------- ---1111111121212211-1222221111122222122322221111122211111111212122211111111111-1--1-----------------------------------------------------12212---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------111----------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111124-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 72.9 SQ:SECSTR #########################################ccTTccccccccccccTTcEEEEEEcTTccEEEEEEccccEEEEEccTTccEEcccTTcccccEEEEEccccEEEEEcccccccEETTEEccccEEEcTTcEEEETTEEEEEE# DISOP:02AL 34-60| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEcccccccccccccccccccccEEEEEEEcccccEEEEEcccEEEEEEcccccEEEcccccccEEEEEEEEccEEEEEEccccccEEEccEEccccEEcccccEEEEccEEEEEEc //