[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54932.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:259 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->149 PF06271 * RDD 1.4e-18 26.7 131/133  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54932.1 GT:GENE BAD54932.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 76248..77027 GB:FROM 76248 GB:TO 77027 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54932.1 LENGTH 259 SQ:AASEQ MAEFTTGEAVALELPIARIPTRAAAFLIDLVVQIGLAVGLMAGIGVLLLQTGADTAWVDTAVVLAMVSVLVGYPVACETLSRGRTLGKLVLGLRVLRTDGGPIDFRHALTRGLAGAIVDFWILGGFGAIAVLTSLCSPTARRVGDVLAGTVVVHAEAALPAPALAVAPPWLIEWATRLDLSGIPEDLALAVRQYLTRLRTLTPQAQDGLGRELVAAVCARLGVPAPPNCPPVQILGAVVAERQRRALAPSAPGGLLRTA GT:EXON 1|1-259:0| TM:NTM 4 TM:REGION 27->49| TM:REGION 58->80| TM:REGION 112->134| TM:REGION 146->168| SEG 82->98|rgrtlgklvlglrvlrt| SEG 151->169|vvvhaeaalpapalavapp| HM:PFM:NREP 1 HM:PFM:REP 17->149|PF06271|1.4e-18|26.7|131/133|RDD| OP:NHOMO 36 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- ----1---------11111-11--1111111111111----1111-1-1---111--1----1----1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 258-259| PSIPRED ccccccccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEHEEEccEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccccccccccc //