[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54940.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   91->221 3gbsA PDBj 2e-04 29.2 %
:RPS:PDB   27->208 1cuiA PDBj 1e-29 21.0 %
:RPS:SCOP  33->149 1bs9A  c.69.1.30 * 3e-11 21.7 %
:HMM:SCOP  32->219 1qozA_ c.69.1.30 * 2.4e-29 28.6 %
:RPS:PFM   88->157 PF01083 * Cutinase 4e-12 55.7 %
:HMM:PFM   32->205 PF01083 * Cutinase 4e-17 26.2 149/179  
:BLT:SWISS 28->137 CUT3_MYCTU 3e-05 32.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54940.1 GT:GENE BAD54940.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 90970..91869 GB:FROM 90970 GB:TO 91869 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54940.1 LENGTH 299 SQ:AASEQ MRWKKVVAGLGASAAIASGLVFGGGATAVADDCPSLYVVAIPGTWETGHEKQPQPGMLSGVTRGLPRNVDVDYVTYAATAFPWEGEVYGNSKKEAVSAARGLIGAMAQRCGGTRMALVGYSQGADAAGDLAAEIGTGLGVVPPDRLAGVGLISDPRRSPTDVQVGPPAPGAGASGPRPGGFGWVSDRVRTICAVDDLYCATAPDDFVTRFAGFLAQSSDANPANIWRYQLEAGAIINDLMAHGGMPTLQAQLSESANQKRAKDLERFYRSQAHTVYGSYSVGGGQTAISWMRNWIAGMA GT:EXON 1|1-299:0| BL:SWS:NREP 1 BL:SWS:REP 28->137|CUT3_MYCTU|3e-05|32.4|102/262| SEG 6->21|vvaglgasaaiasglv| SEG 165->182|gppapgagasgprpggfg| BL:PDB:NREP 1 BL:PDB:REP 91->221|3gbsA|2e-04|29.2|106/187| RP:PDB:NREP 1 RP:PDB:REP 27->208|1cuiA|1e-29|21.0|162/197| RP:PFM:NREP 1 RP:PFM:REP 88->157|PF01083|4e-12|55.7|70/190|Cutinase| HM:PFM:NREP 1 HM:PFM:REP 32->205|PF01083|4e-17|26.2|149/179|Cutinase| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF01083|IPR000675| GO:PFM GO:0016787|"GO:hydrolase activity"|PF01083|IPR000675| RP:SCP:NREP 1 RP:SCP:REP 33->149|1bs9A|3e-11|21.7|115/207|c.69.1.30| HM:SCP:REP 32->219|1qozA_|2.4e-29|28.6|185/0|c.69.1.30|1/1|alpha/beta-Hydrolases| OP:NHOMO 53 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- -----11111111211111-11111111111112125465----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 198 STR:RPRED 66.2 SQ:SECSTR #######################HHHHccGGGcccEEEEEEccTTccTTTTTTHHHHHHHHHHHHcGGEEEEEccTTccccGGGGGcTTcccHHHHHHHHHHHHHHHHHcTTcEEEEEEETHHHHHHHHHHHHHHHHccHHHHTTEEEEEEEccTTTTTTTTccEcccccccTTcccTTcTTccGGGEEEEccTTcGGGGTcccccGGGGHHHHHHHHHHH############################################################################## DISOP:02AL 299-300| PSIPRED ccHHHHHHHHHHHHHHcccccccccccccccccccEEEEEccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHHHHcccccccccHHHHEEEEEEEccccccccccccccccccccccccccccccccHHHEEEcccccEEcccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccHHcccccccccccHHHHHHHHHHHHcc //