[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54941.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:119 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->81 PF11837 * DUF3357 0.00064 20.0 65/107  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54941.1 GT:GENE BAD54941.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(91884..92243) GB:FROM 91884 GB:TO 92243 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54941.1 LENGTH 119 SQ:AASEQ MPPHRRGAHAEKGHPLTSQRFSLSRTSLRRGSARVALAGALALVPLGALAATAAAEAPADDAVVVQEAAPQAADISRPFDRDRPGPGPDRIIFRDERDPRGDGPVVLERRLLPPTGSAG GT:EXON 1|1-119:0| TM:NTM 1 TM:REGION 33->55| SEG 35->73|valagalalvplgalaataaaeapaddavvvqeaapqaa| SEG 77->90|rpfdrdrpgpgpdr| HM:PFM:NREP 1 HM:PFM:REP 17->81|PF11837|0.00064|20.0|65/107|DUF3357| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12, 115-119| PSIPRED cccccccccccccccccccHHHHHHHHHHccccEEHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccccccccccccccccEEEEEccccccccccEEEEEEccccccccc //