[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54942.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.60.1
:225 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   23->204 1c7zA PDBj 7e-18 16.7 %
:RPS:SCOP  23->214 1ebbA  c.60.1.1 * 8e-15 18.0 %
:HMM:SCOP  21->220 1xq9A_ c.60.1.1 * 2.6e-35 31.0 %
:HMM:PFM   23->172 PF00300 * PGAM 2.9e-23 28.2 149/158  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54942.1 GT:GENE BAD54942.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(92306..92983) GB:FROM 92306 GB:TO 92983 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54942.1 LENGTH 225 SQ:AASEQ MSAAPPEPDAHARFPVRHSERVQLILVRHAQPLRVVDAAGPADPDLSEIGREQAERVPAALSHHHRITRVLSSPQARARQTAAPTAAKLGLPVEIVDDLAEYDRDLPAYIPIEDAKLEFRDAYERIKAGHLPEQIDGPAFVRRVLAAVDTVVAGTEPEDTVVAFAHGGVVNVLLQDVLGLARPLTFPIDYCSITRVLFSRTGRRSAATVNENGHVWDLLPRNRDR GT:EXON 1|1-225:0| SEG 72->87|sspqararqtaaptaa| RP:PDB:NREP 1 RP:PDB:REP 23->204|1c7zA|7e-18|16.7|174/191| HM:PFM:NREP 1 HM:PFM:REP 23->172|PF00300|2.9e-23|28.2|149/158|PGAM| RP:SCP:NREP 1 RP:SCP:REP 23->214|1ebbA|8e-15|18.0|189/202|c.60.1.1| HM:SCP:REP 21->220|1xq9A_|2.6e-35|31.0|200/0|c.60.1.1|1/1|Phosphoglycerate mutase-like| OP:NHOMO 15 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ---------------11----1--11-----111111112----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 214 STR:RPRED 95.1 SQ:SECSTR ##cccTTTccccEETTcccccccEEEEEccccHHHHTTcccccccccHHHHHHHHHHHHHHHTTccccEEEEEccHHHHHHHHHHHTTTccccEEEGGGcccccGGGTTccHHHHHHHcHHHHHHHHHcTTTcccTTcHHHHHHHHHHHHHHHHTHTcccEEEEEcHHHHHHHHHHHTTcTTGGGccccccEEEEEEEETTEEEEEEEEEEcTTEE######### DISOP:02AL 1-10, 221-225| PSIPRED cccccccccccccccccccccEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHHHHHHHHccccEEEcccHHcccccccccccHHHHHHHccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHcccHHHHccccccEEEEEEEcccccEEEEEEcccHHHHHHccccccc //