Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54943.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:154 amino acids
:HMM:PFM   49->134 PF06682 * DUF1183 2.7e-05 19.0 63/321  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54943.1 GT:GENE BAD54943.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(93057..93521) GB:FROM 93057 GB:TO 93521 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54943.1 LENGTH 154 SQ:AASEQ MYLDLLTNTNLLDHAVWASPDTWGSSDTYTQAMEYAARRRRRGGGGLIFGAICCVAVIAAIGVGIYLMTKRKKNNDQGGQAPYGQPGGQPPYGAPGGGQPYGQGGESGGQTYGQSYGAPGGQPPYGAPGDQPPYGAPGDQPPSGPSGPPPTGKS GT:EXON 1|1-154:0| TM:NTM 1 TM:REGION 45->66| SEG 3->13|ldlltntnlld| SEG 38->46|rrrrrgggg| SEG 50->65|gaiccvaviaaigvgi| SEG 77->153|qggqapygqpggqppygapgggqpygqggesggqtygqsygapggqppygapgdqppygapgdqppsgpsgppptgk| HM:PFM:NREP 1 HM:PFM:REP 49->134|PF06682|2.7e-05|19.0|63/321|DUF1183| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 68-154| PSIPRED cEEEccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //