Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54944.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:182 amino acids
:HMM:PFM   88->123 PF03748 * FliL 6.1e-05 25.0 36/149  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54944.1 GT:GENE BAD54944.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(93617..94165) GB:FROM 93617 GB:TO 94165 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54944.1 LENGTH 182 SQ:AASEQ MFPGGVNESPRAAITLETRPGGAETNEKRDGGFMYLDVLSGASVLDHSVWASPDTLLASDTYAQAIEHLAKRRRNRGSGGGGGGRGGLIFGAVCCVLVIVAIGVGIYLMTKRKKNNDQGGQAPYGRPGGQLPYGQAAYGQAPYGQTGEQPLYGQQPYGQPPYGAPGGQPPYGGHGGQPPYGH GT:EXON 1|1-182:0| TM:NTM 1 TM:REGION 86->107| SEG 72->87|rrrnrgsggggggrgg| SEG 147->181|geqplygqqpygqppygapggqppygghggqppyg| HM:PFM:NREP 1 HM:PFM:REP 88->123|PF03748|6.1e-05|25.0|36/149|FliL| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 20-26, 71-87, 110-182| PSIPRED cccccccccccEEEEEEcccccccccccccccEEEEEEcccccHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccccccEEHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //