[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54947.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  76/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.66.1
:73 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->72 1o09A PDBj 2e-07 40.7 %
:RPS:PDB   4->67 3bbnD PDBj 4e-08 10.9 %
:RPS:SCOP  7->70 1jh3A  d.66.1.4 * 3e-08 20.3 %
:HMM:SCOP  3->72 1p9kA_ d.66.1.6 * 2.1e-16 47.1 %
:HMM:PFM   18->61 PF01479 * S4 3e-08 36.4 44/48  
:BLT:SWISS 1->65 YAAA_BACSU 1e-11 52.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54947.1 GT:GENE BAD54947.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(98138..98359) GB:FROM 98138 GB:TO 98359 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54947.1 LENGTH 73 SQ:AASEQ MSDPVDVPITDDLIKLGQFLKLANLIDSGSEAKTVIAAGLVRVNDEVELRRGRQLQVGDVVILAGHKVRVAAA GT:EXON 1|1-73:0| BL:SWS:NREP 1 BL:SWS:REP 1->65|YAAA_BACSU|1e-11|52.4|63/71| BL:PDB:NREP 1 BL:PDB:REP 14->72|1o09A|2e-07|40.7|59/79| RP:PDB:NREP 1 RP:PDB:REP 4->67|3bbnD|4e-08|10.9|64/199| HM:PFM:NREP 1 HM:PFM:REP 18->61|PF01479|3e-08|36.4|44/48|S4| RP:SCP:NREP 1 RP:SCP:REP 7->70|1jh3A|3e-08|20.3|64/99|d.66.1.4| HM:SCP:REP 3->72|1p9kA_|2.1e-16|47.1|70/79|d.66.1.6|1/1|Alpha-L RNA-binding motif| OP:NHOMO 76 OP:NHOMOORG 76 OP:PATTERN -------------------------------------------------------------------- -----111111111-------1---1------11111111-1111---1---11111-----111-1---------------1----------------------------------------------------------------1-1---11--------1-----------1-1-----111---1-111-----------------11-1---------1------1--------------------------------------------------------------------------------------------11-------1--1--1------1-1-11-1--------1-----1--11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------11111-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 69 STR:RPRED 94.5 SQ:SECSTR ###TTTTTTHHHHccTTTTTTTTTcccccHHHHHHHHTTcEEETTEEcccTTccccTTEEEEEcccTEEEEc# DISOP:02AL 1-2| PSIPRED ccccEEEEEcccEEEHHHHHHHcccccccHHHHHHHHcccEEEccEEEcccccEEccccEEEEccEEEEEEEc //