[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54948.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:130 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   68->98 PF05478 * Prominin 2.2e-05 35.5 31/809  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54948.1 GT:GENE BAD54948.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(98408..98800) GB:FROM 98408 GB:TO 98800 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54948.1 LENGTH 130 SQ:AASEQ MLSGMSGRTCPSPAQRLAYIGGATLPPSMSEWVLADLTGPGATRRYLTRILLPIIPVLSLLLLLPGPLWMGLAMMALLYLPLIYFTIALMYVYRRHRLLQHGLDPALADADVRARGAAERLAYERKHGRA GT:EXON 1|1-130:0| TM:NTM 2 TM:REGION 46->68| TM:REGION 72->93| SEG 50->68|illpiipvlslllllpgpl| HM:PFM:NREP 1 HM:PFM:REP 68->98|PF05478|2.2e-05|35.5|31/809|Prominin| OP:NHOMO 19 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- --------------2------1--12-----111112222----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 125-130| PSIPRED ccccccccccccHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccc //