[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54949.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.129.3
:152 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->109 2o2sB PDBj 5e-04 28.7 %
:RPS:PDB   1->146 2b79A PDBj 1e-10 7.5 %
:RPS:SCOP  11->145 2pcsA1  d.129.3.10 * 2e-11 14.4 %
:HMM:SCOP  4->151 2d4rA1 d.129.3.6 * 1.1e-18 22.0 %
:HMM:PFM   9->141 PF10604 * Polyketide_cyc2 2.9e-13 24.0 125/139  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54949.1 GT:GENE BAD54949.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(98813..99271) GB:FROM 98813 GB:TO 99271 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54949.1 LENGTH 152 SQ:AASEQ MTVVKIVGECAASAESAFRYVNDYRNLPRFLHGIQSFTPVGSRTEGVGAVFDGTMKLGPATLHSRVEVVRWEEGAAIGIKSIKGFDLESTFLFHPRGEDRSTVDAIVDYRVPGGLAGKALGRTIEPFVKIAVKHTNDNLLRQIAEFHARGAA GT:EXON 1|1-152:0| BL:PDB:NREP 1 BL:PDB:REP 8->109|2o2sB|5e-04|28.7|101/302| RP:PDB:NREP 1 RP:PDB:REP 1->146|2b79A|1e-10|7.5|134/142| HM:PFM:NREP 1 HM:PFM:REP 9->141|PF10604|2.9e-13|24.0|125/139|Polyketide_cyc2| RP:SCP:NREP 1 RP:SCP:REP 11->145|2pcsA1|2e-11|14.4|132/147|d.129.3.10| HM:SCP:REP 4->151|2d4rA1|1.1e-18|22.0|141/0|d.129.3.6|1/1|Bet v1-like| OP:NHOMO 9 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------1---------------------2132----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 152 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEEEcccHHHHHHHHHcGGGGGGTcTTEEEEEEcccETccTTcEEEEEETTcccEccEEEEEccccTTTEEEEEEEETTEEEEEEEEEEcTTccEEEEEEEEEccccTTTTTTTccTTHHHHHHHHHTTHHHHHHHHHHHHHHTTc DISOP:02AL 151-152| PSIPRED cEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcEEEEcccccccccHHHHHHHHHccEEEEEEEEEEEEEccEEEEEEEEccccccEEEEEEEcccccEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //