[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54950.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:208 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   2->128 2b25B PDBj 2e-07 4.7 %
:RPS:SCOP  2->172 2gh1A1  c.66.1.49 * 9e-10 13.5 %
:HMM:SCOP  2->136 1i9gA_ c.66.1.13 * 2.2e-12 21.5 %
:HMM:PFM   97->150 PF07336 * DUF1470 0.0002 31.2 48/132  
:BLT:SWISS 26->73 Y1440_MYCBO 1e-05 37.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54950.1 GT:GENE BAD54950.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(99268..99894) GB:FROM 99268 GB:TO 99894 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54950.1 LENGTH 208 SQ:AASEQ MDLSAALIGELARHAAELPQVRTHVADATTWPHDGYDVVQAVLGVFFFPDMAAGTEHLISRARPGGRVGCTIWRRGSMVLAGKHLGNAITAITGTPVRKRPEHPVDRIDDAEAFGSWLTERGLTDVTVVEHPLRLALAPELAWLIVTGSGFVGALADLDRDQVAAVHRRYLDSLAAAGVTDIDATTLIGVGTRVAANSPRTRADTVAS GT:EXON 1|1-208:0| BL:SWS:NREP 1 BL:SWS:REP 26->73|Y1440_MYCBO|1e-05|37.5|48/274| RP:PDB:NREP 1 RP:PDB:REP 2->128|2b25B|2e-07|4.7|127/239| HM:PFM:NREP 1 HM:PFM:REP 97->150|PF07336|0.0002|31.2|48/132|DUF1470| RP:SCP:NREP 1 RP:SCP:REP 2->172|2gh1A1|9e-10|13.5|170/281|c.66.1.49| HM:SCP:REP 2->136|1i9gA_|2.2e-12|21.5|130/0|c.66.1.13|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-11-----------------1------1------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 191 STR:RPRED 91.8 SQ:SECSTR EEccHHHHHHHHHHHHHHHTccccccccEEEEEccTTcccEEEEEEccccGGGGHHHHGGGEEEEEEEEEEEccHHHHHHHHHHHHHTTccEEEEEEEccccccEEEcccEEEcccccccccEEEEEEcccccTTcTHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHTTcccccccEEEEEccEEEEEE################# DISOP:02AL 202-208| PSIPRED ccccHHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEccccccccccccccc //