[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54951.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:309 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   206->305 PF05425 * CopD 3.6e-20 44.4 99/105  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54951.1 GT:GENE BAD54951.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(99949..100878) GB:FROM 99949 GB:TO 100878 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54951.1 LENGTH 309 SQ:AASEQ MSAPTTGRDAAALLAVVPAGLLGVGLAWLLARPDPAPVAGVVRVLADCAGATVLGLAALPRLHDRLRPPWLALAVLGGVWWVAEGAVLLFEAADVVGVPVGELDPRRFGTYLTGVSGGQIGVAVLVGTAVLTGYAALAYRRGDDPSPDLVLVFAAVALALRPVTGHMSQQPLGSILAAVHALAAGTWFGVLVALALVVRGRREWAATLPRYSALAVPLVAVVGVTGIVNGLIRLGGLTALLDTGYGRILLAKATLLAVLLALGWWWRRDWVRRAADHRMDAAASLRRAVLEVAVMAVAFGLAAVLAVTA GT:EXON 1|1-309:0| TM:NTM 9 TM:REGION 9->31| TM:REGION 38->60| TM:REGION 74->96| TM:REGION 118->139| TM:REGION 145->167| TM:REGION 175->197| TM:REGION 216->238| TM:REGION 242->263| TM:REGION 288->309| SEG 10->31|aaallavvpagllgvglawlla| SEG 149->160|lvlvfaavalal| SEG 189->202|gvlvalalvvrgrr| SEG 213->230|alavplvavvgvtgivng| SEG 249->262|llakatllavllal| SEG 264->283|wwwrrdwvrraadhrmdaaa| SEG 292->308|vavmavafglaavlavt| HM:PFM:NREP 1 HM:PFM:REP 206->305|PF05425|3.6e-20|44.4|99/105|CopD| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //