[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54952.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.1.18
:177 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->115 1lyqB PDBj 3e-05 33.3 %
:RPS:PDB   37->115 2c9rA PDBj 6e-08 23.1 %
:RPS:SCOP  37->115 1ix2A  b.1.18.17 * 2e-15 29.5 %
:HMM:SCOP  28->123 1lyqA_ b.1.18.17 * 2.4e-26 46.3 %
:RPS:PFM   37->115 PF04234 * CopC 7e-13 45.6 %
:HMM:PFM   7->122 PF04234 * CopC 1.2e-34 41.4 116/121  
:BLT:SWISS 47->115 PCOC_ECOLX 8e-05 33.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54952.1 GT:GENE BAD54952.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(100889..101422) GB:FROM 100889 GB:TO 101422 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54952.1 LENGTH 177 SQ:AASEQ MTARLLRIVLTALLAVGLALTAGGVAAAHSSAVGSVPENGARVDKGPERISVTFNEDLQPNFPSLTLVGPDGNLWSRGEPTVEGKTVSVAAGELGPAGEYTIAFRVTSADGHPVSGTRTFTLTTPGTGTPGDRADAAAESANGEGGVPLWVFVLGAVALFGAGLAVALFGFRGRGRG GT:EXON 1|1-177:0| BL:SWS:NREP 1 BL:SWS:REP 47->115|PCOC_ECOLX|8e-05|33.3|69/126| TM:NTM 2 TM:REGION 6->28| TM:REGION 148->170| SEG 9->36|vltallavglaltaggvaaahssavgsv| SEG 116->131|gtrtftlttpgtgtpg| SEG 151->171|vfvlgavalfgaglavalfgf| BL:PDB:NREP 1 BL:PDB:REP 47->115|1lyqB|3e-05|33.3|69/104| RP:PDB:NREP 1 RP:PDB:REP 37->115|2c9rA|6e-08|23.1|78/97| RP:PFM:NREP 1 RP:PFM:REP 37->115|PF04234|7e-13|45.6|79/121|CopC| HM:PFM:NREP 1 HM:PFM:REP 7->122|PF04234|1.2e-34|41.4|116/121|CopC| GO:PFM:NREP 3 GO:PFM GO:0005507|"GO:copper ion binding"|PF04234|IPR007348| GO:PFM GO:0042597|"GO:periplasmic space"|PF04234|IPR007348| GO:PFM GO:0046688|"GO:response to copper ion"|PF04234|IPR007348| RP:SCP:NREP 1 RP:SCP:REP 37->115|1ix2A|2e-15|29.5|78/102|b.1.18.17| HM:SCP:REP 28->123|1lyqA_|2.4e-26|46.3|95/0|b.1.18.17|1/1|E set domains| OP:NHOMO 23 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- --------------11-----3---1------21122211------------------------111-1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 44.1 SQ:SECSTR ####################################ccTTc#EEcccccEEEEEcccccGGGcEEEEEEEEcccEEEcEEEEEcccTTEEEEEEcccEEEEEEEEEccTTcccEE############################################################## DISOP:02AL 1-4, 78-79, 127-139, 176-177| PSIPRED cHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccccccHHHccccEEEEEEcccccccccEEEEEcccccEEccccccccccEEEEEccccccccEEEEEEEEEEEccEEEccEEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccc //