[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54953.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:219 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->164 3esmA PDBj 2e-53 84.3 %
:HMM:PFM   13->86 PF07987 * DUF1775 6.5e-22 37.0 73/77  
:BLT:SWISS 29->149 YCNI_BACSU 5e-12 31.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54953.1 GT:GENE BAD54953.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(101419..102078) GB:FROM 101419 GB:TO 102078 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54953.1 LENGTH 219 SQ:AASEQ MRSSLSRACGTAVAAVGVVLLTGGTAAAHVTADAPGAAQGGYSVVTFRVPTESETAATTALTVTLPNVRSARTEPLPGWTARVDRNDKSEAVSVTWTADPGNPGVQPGQFQRFVVSIGPLPSAETVSFPAEQTYSDGRVVAWNQPPAADGSEPEHPAPTLTLATAPGDTAADGHHVGTEAAHADDASDETARWLGGIGLALGLFAVALGLGTVIRGRRA GT:EXON 1|1-219:0| BL:SWS:NREP 1 BL:SWS:REP 29->149|YCNI_BACSU|5e-12|31.4|118/100| TM:NTM 2 TM:REGION 5->27| TM:REGION 193->215| SEG 10->28|gtavaavgvvlltggtaaa| SEG 49->66|vptesetaattaltvtlp| SEG 194->211|lggiglalglfavalglg| BL:PDB:NREP 1 BL:PDB:REP 29->164|3esmA|2e-53|84.3|134/136| HM:PFM:NREP 1 HM:PFM:REP 13->86|PF07987|6.5e-22|37.0|73/77|DUF1775| OP:NHOMO 31 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ----3---------111-------------------1111-1111----111-1------11--11-211---------------------------------------------------------------------------------------------------------------------------1-----------------11-1---------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 134 STR:RPRED 61.2 SQ:SECSTR ############################ccEEEcccccTTccEEEEEEEEcccccccEEEEEEEEEEEcEEEEcccTTEEEEEEEcTTccEEEEEEEEcTTcccccTTcEEEEEEEEEccccccEEEccEEEEETTccEEEEcc##ccccccccccccEEEccc####################################################### DISOP:02AL 1-5, 166-191, 218-219| PSIPRED cccccHHHHHHHHHHHHHHHHHcccEEEEEEEEccccccccEEEEEEEccccccccccEEEEEEcccEEEccccccccEEEEEEEcccccEEEEEEEEccccccccccccEEEEEEEEccccccEEEEEEEEEcccccEEEEccccccccccccccccEEEEEcccccccccccccccHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //