[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54954.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:176 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54954.1 GT:GENE BAD54954.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(102115..102645) GB:FROM 102115 GB:TO 102645 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54954.1 LENGTH 176 SQ:AASEQ MSSGPSLGWPRGGLVGAVVGLLGVAAHGAAGGGYPDTAELALLLMVSTAVGAAAVPRAQSAAAPVPVPVLLALGQFAAHVVLSGLSGHPAHGTAPTAVPSGWMITAHVVATVACAVLLASAERLYRAASGTIRALFGVPRPPAPVAVLPVPAVGRRHYRSVPKGVAAPRAPPVWSS GT:EXON 1|1-176:0| SEG 12->33|gglvgavvgllgvaahgaaggg| SEG 49->73|avgaaavpraqsaaapvpvpvllal| SEG 105->121|tahvvatvacavllasa| SEG 137->156|gvprppapvavlpvpavgrr| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 174-176| PSIPRED cccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccccccEEEEccccHHHHHHHHcccccccccccccccc //