[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54958.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  174/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:238 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->80 PF01169 * UPF0016 3e-06 42.9 %
:HMM:PFM   8->80 PF01169 * UPF0016 5.5e-21 47.9 73/78  
:HMM:PFM   106->181 PF01169 * UPF0016 3.5e-23 43.4 76/78  
:BLT:SWISS 1->145 Y615_SYNY3 8e-10 33.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54958.1 GT:GENE BAD54958.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 107596..108312 GB:FROM 107596 GB:TO 108312 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54958.1 LENGTH 238 SQ:AASEQ MITTIALSIGIVFLAELGDKSQLMALTFALRYRWWVVLGGIATASAGVHILSVAVGHFLGAALPTRAIALVAALTFLAVGLWTLREHLVGGEEDAPPAPRSSRAPFLVVLSAFLLAELGDRTMFATAALATDNHWFGVWIGSTVGMVAADGLAIALGILLGKHLPEHIIGIASGLLFLLFGGATLLSALAPALSAVAGLALAALLPAAAGAAMLIRKRRRAAAGAGREPDPLAVPRPE GT:EXON 1|1-238:0| BL:SWS:NREP 1 BL:SWS:REP 1->145|Y615_SYNY3|8e-10|33.8|142/206| TM:NTM 7 TM:REGION 1->23| TM:REGION 35->57| TM:REGION 62->84| TM:REGION 99->121| TM:REGION 138->160| TM:REGION 166->188| TM:REGION 193->215| SEG 95->105|appaprssrap| SEG 148->161|aadglaialgillg| SEG 169->212|igiasgllfllfggatllsalapalsavaglalaallpaaagaa| SEG 218->227|rrraaagagr| RP:PFM:NREP 1 RP:PFM:REP 11->80|PF01169|3e-06|42.9|70/76|UPF0016| HM:PFM:NREP 2 HM:PFM:REP 8->80|PF01169|5.5e-21|47.9|73/78|UPF0016| HM:PFM:REP 106->181|PF01169|3.5e-23|43.4|76/78|UPF0016| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF01169|IPR001727| OP:NHOMO 177 OP:NHOMOORG 176 OP:PATTERN ------------------------------------------------1------------------- -----------------11-11--1111111111111111-------1------------11--1-1---1------------------------------------------------------111111-11-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1------------11------------1----------1-1-----------1----------------------------------------1-----------------------------------------1---------------------------------11-------111111-111111111111111111111-1111111111-111111-----11--------111111------------1--1-1111--11111-1----------------------------111-1---1--11111111111-1-11-11--------------------------------------------------------------------------------------------------------------1111---------------11111-1---2111111111111111111----------111-1111111111----------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 88-101, 217-234, 236-238| PSIPRED cHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc //