[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54962.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:176 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54962.1 GT:GENE BAD54962.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(110919..111449) GB:FROM 110919 GB:TO 111449 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54962.1 LENGTH 176 SQ:AASEQ MTTSDTSIGITPFHSRGSLRGFVISGRWPDTTKEWAQVLVLAVRVASLPGLLPTTTVFGVREELPDDPQPGTVGLVMAEGPVLGEEAVEPGRFAEHVPPALLMLHPPSETRPSLPECAGAASGCVLLPGVPHLGLEHRAAWAEAESDGTVTSLVSRVGLDPISDPDTAVLAMLLAA GT:EXON 1|1-176:0| OP:NHOMO 26 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- --------------11111-11111111111111111111-----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccccccEEEEcccccccEEEEEEEcccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccEEEEEEEcccccHHHHcccHHHcccccEEEEEcccccccccHHHHHHHHHHHHHcccccccccHHHHHccccccccHHHHHHHHHcccccccccHHHHHHHHcc //