[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54969.1
DDBJ      :             putative ferritin family protein
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  239/915 : Eukaryota  17/199 : Viruses  0/175   --->[See Alignment]
a.25.1
:182 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->145 2jd60 PDBj 2e-19 35.4 %
:RPS:PDB   15->153 3e6sB PDBj 2e-20 25.9 %
:RPS:SCOP  16->155 1eumA  a.25.1.1 * 9e-37 23.6 %
:HMM:SCOP  1->152 2ceiA1 a.25.1.1 * 6.5e-42 40.1 %
:RPS:PFM   16->144 PF00210 * Ferritin 3e-12 34.9 %
:HMM:PFM   15->149 PF00210 * Ferritin 5.2e-33 34.3 134/142  
:BLT:SWISS 16->153 FTN_STAAR 2e-17 34.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54969.1 GT:GENE BAD54969.1 GT:PRODUCT putative ferritin family protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(117089..117637) GB:FROM 117089 GB:TO 117637 GB:DIRECTION - GB:PRODUCT putative ferritin family protein GB:PROTEIN_ID BAD54969.1 LENGTH 182 SQ:AASEQ MSSHPENPRSKFHSLLHDQIRHEFNAEHQYIAIAVWFDNADLPQLAKRFYRQAVEERNHALMIVQYFLDRDISVELSGIDAAKSHFETAREPIALALAQEKTVTEQIIRLASTAREEGDYLGEQFMQWFLKEQVEEVANMTTLLNIADRAGSNLFDLEDFVAREMSGPADASYAPSVAGGSV GT:EXON 1|1-182:0| BL:SWS:NREP 1 BL:SWS:REP 16->153|FTN_STAAR|2e-17|34.1|138/166| BL:PDB:NREP 1 BL:PDB:REP 16->145|2jd60|2e-19|35.4|130/167| RP:PDB:NREP 1 RP:PDB:REP 15->153|3e6sB|2e-20|25.9|139/158| RP:PFM:NREP 1 RP:PFM:REP 16->144|PF00210|3e-12|34.9|129/141|Ferritin| HM:PFM:NREP 1 HM:PFM:REP 15->149|PF00210|5.2e-33|34.3|134/142|Ferritin| GO:PFM:NREP 2 GO:PFM GO:0006879|"GO:cellular iron ion homeostasis"|PF00210|IPR008331| GO:PFM GO:0008199|"GO:ferric iron binding"|PF00210|IPR008331| RP:SCP:NREP 1 RP:SCP:REP 16->155|1eumA|9e-37|23.6|140/161|a.25.1.1| HM:SCP:REP 1->152|2ceiA1|6.5e-42|40.1|152/0|a.25.1.1|1/1|Ferritin-like| OP:NHOMO 308 OP:NHOMOORG 275 OP:PATTERN --1----------------1------------1-1--1111111---1-1-----1--111-----11 -----11-1111-12--11-11--1111111111112222------1-----111-11----11112-----------1-111-------11-1111--1-21-1111-1--------------1-1-1-11---111111---1----1----------1----1------2-----1-------------1-11111111-11111111----111---1----------1111111111111111-1111----------------------------------------------------------------------111111111111-1-1111-1111111-1----11-----11-11111--1-----------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------1-1111-11111----1---11-------------111111-1--------------11----------1111---1111-1--1--1------------------1-----------------------------------111------------------------11------------------------------11122212222-222---------1-------------------111111-1111--11111111111--------------------------------1---------------------------11111111111-1 --------------2----------------------------------------------------------------------------------------122---1--------------11------------------------------------1--2-1--2--2-1--1A----------1-1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 168 STR:RPRED 92.3 SQ:SECSTR #ccccTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccccccccGGGccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHTTccccccccHc############# DISOP:02AL 1-6, 166-182| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHccHHHHHHHHcccccccccccccccccc //