[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54973.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.45.1
:253 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   78->242 2arzA PDBj 3e-15 20.1 %
:RPS:SCOP  116->242 2arzA1  b.45.1.1 * 2e-14 22.3 %
:HMM:SCOP  8->250 2arzA1 b.45.1.1 * 2e-28 33.8 %
:HMM:PFM   159->238 PF10615 * DUF2470 8.7e-11 26.0 77/83  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54973.1 GT:GENE BAD54973.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(120519..121280) GB:FROM 120519 GB:TO 121280 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54973.1 LENGTH 253 SQ:AASEQ MPNPVLVPSTAERVRSACAHAEQAVLALPGIDPTPTSVHHLRQCGDVVVAVPAGSVAAVLTANSGPGGAAAVLELTDHAPLPLREPVRALVWLRGAVRTVPQSAQRALAGEVAKEFPHPELLDVGHGATLLRLVIDTAVMADATGAESVRVEELRSAQPDPFCQMESAWLQHLDADHPDILEQLARHLPPRLQTGAVHPLAIDRYGLTLRVEGHDGDHDVRLPFTAPVDDVEALSRAVRALAGCPFLNGLRRI GT:EXON 1|1-253:0| SEG 47->59|vvvavpagsvaav| RP:PDB:NREP 1 RP:PDB:REP 78->242|2arzA|3e-15|20.1|159/238| HM:PFM:NREP 1 HM:PFM:REP 159->238|PF10615|8.7e-11|26.0|77/83|DUF2470| RP:SCP:NREP 1 RP:SCP:REP 116->242|2arzA1|2e-14|22.3|121/238|b.45.1.1| HM:SCP:REP 8->250|2arzA1|2e-28|33.8|231/0|b.45.1.1|1/1|FMN-binding split barrel| OP:NHOMO 33 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- --------------11111-11--1111111111111111----1---------------11--111112----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 236 STR:RPRED 93.3 SQ:SECSTR #cccccccHHHHHHHHHHHHccEEEEEEEcTTEEEEEEEcEEcTTccEEEEEETTcHHHHHH#HccEEEEEEccTTcEcTTcccTTcccEEEEEEEEEEccHHHHHHHHHHHHHHcGGGTTccTTccEEEEEEEEEEEEEEcTTcEEEEETTTcccccTTTTHHHHHHHHHHHHHHcHHHHHHHHHTHHccccccccEEEEEcccEEEEEE####TTEEEEEEcccccccHHHHHHHHHHHH########### DISOP:02AL 1-4| PSIPRED cccccccccHHHHHHHHHHHcccEEEEEEcccccccEEEEEEEcccEEEEccHHHHHHHHHHcccccccHHHHHHHcccccccccHHHHEEEEEEEEEcccHHHHHHHHHHHHHHcccHHHHHcccccEEEEEEEEEEEEEccccccEEcHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccHHHHEEccccccEEEEEcccccEEEEEcccccHHHHHHHHHHHHHHHcccHHHHHHcc //