[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54974.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:141 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   43->83 PF04273 * DUF442 0.00014 39.0 41/110  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54974.1 GT:GENE BAD54974.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 121416..121841 GB:FROM 121416 GB:TO 121841 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54974.1 LENGTH 141 SQ:AASEQ MADAPTPAGNPPHEPVLVTLSTPARRSLVAGLVRPVTPRPEAPVLHADGSDAEVADFLAAIAHAETGYLARTDSGPRALAVVAATAAALCGEDIRAALAAPDLAFLTALKPPAIEAVRGVLLAVETEQPEAVRAALAVLEP GT:EXON 1|1-141:0| SEG 78->89|alavvaataaal| HM:PFM:NREP 1 HM:PFM:REP 43->83|PF04273|0.00014|39.0|41/110|DUF442| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9| PSIPRED cccccccccccccccEEEEEcccHHHHHHHHHHccccccccccEEEcccccHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHEEEEEEccccHHHHHHHHHccc //