[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54978.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.4
:385 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  10->179 2g38B1  a.25.4.2 * 3e-06 12.9 %
:HMM:SCOP  9->179 2g38B1 a.25.4.2 * 2.9e-26 30.4 %
:HMM:PFM   15->166 PF00823 * PPE 1.3e-27 32.9 152/159  
:HMM:PFM   202->240 PF09664 * DUF2399 0.00016 41.0 39/155  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54978.1 GT:GENE BAD54978.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(124409..125566) GB:FROM 124409 GB:TO 125566 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54978.1 LENGTH 385 SQ:AASEQ MTAGITGVFWLPRMAEANSIALNAGAHAVPISAAATAWGALTAAWVDATATVTRVMAELGVGMQGVNGIAALSRLVGFTGWAEQQGVMAAAMGSKAAANATAYTVASLAMPSLPEILATNAAVVASANPAGAVSGAFEAAELAKHAMDLRAALVMETYEAATTAVVTTPGEFHAPPPIADGAGTASPAQSAETSFQGDPVQTALATAASVVNNPAVVSAATQAANVAGTVATSGVSTVGNLGASAIAAATGAAPAAPVAAAPAAVMGAGPAAGGAGAAATRSATVGLGGSVNLQNGSLKLPEGWGSGLQSAAPAATPATEVVARVETAPARAANAPGSPLLGRTQSAEDEETEHKAADYLRGDHFGDGRYAADGVIGADPAGTAR GT:EXON 1|1-385:0| SEG 33->55|aaatawgaltaawvdatatvtrv| SEG 89->109|aaamgskaaanataytvasla| SEG 118->136|atnaavvasanpagavsga| SEG 160->168|aattavvtt| SEG 205->221|ataasvvnnpavvsaat| SEG 242->286|gasaiaaatgaapaapvaaapaavmgagpaaggagaaatrsatvg| SEG 311->333|aapaatpatevvarvetaparaa| HM:PFM:NREP 2 HM:PFM:REP 15->166|PF00823|1.3e-27|32.9|152/159|PPE| HM:PFM:REP 202->240|PF09664|0.00016|41.0|39/155|DUF2399| RP:SCP:NREP 1 RP:SCP:REP 10->179|2g38B1|3e-06|12.9|170/173|a.25.4.2| HM:SCP:REP 9->179|2g38B1|2.9e-26|30.4|171/0|a.25.4.2|1/1|PE/PPE dimer-like| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 192-202, 274-277, 329-352, 383-385| PSIPRED ccccccEEEEccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccHHHHcccHHcccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHccHHHHHHHHcccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHcccccccccccHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccc //