[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54979.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.4
:107 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  9->84 2g38A1 a.25.4.1 * 1.6e-05 34.2 %
:HMM:PFM   4->83 PF00934 * PE 8.3e-17 32.5 80/94  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54979.1 GT:GENE BAD54979.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(125607..125930) GB:FROM 125607 GB:TO 125930 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54979.1 LENGTH 107 SQ:AASEQ MVGHVSISPELILAAAAELDLLAERLAAAATLSGPATHVLPSGAEEVSLLAAQHFNKAAATHDHSIAQGILELHHAANVLRMQLATHVAEDVVKAGVMNSVAGTIGA GT:EXON 1|1-107:0| SEG 10->32|elilaaaaeldllaerlaaaatl| HM:PFM:NREP 1 HM:PFM:REP 4->83|PF00934|8.3e-17|32.5|80/94|PE| HM:SCP:REP 9->84|2g38A1|1.6e-05|34.2|76/0|a.25.4.1|1/1|PE/PPE dimer-like| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //