[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54980.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  69/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.92.1
:116 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->115 3e11A PDBj 2e-23 48.6 %
:RPS:SCOP  3->115 3e11A1  d.92.1.17 * 3e-28 48.2 %
:RPS:PFM   30->114 PF06262 * DUF1025 1e-09 37.6 %
:HMM:PFM   31->115 PF06262 * DUF1025 1.1e-31 49.4 85/97  
:PROS 94->103|PS00142|ZINC_PROTEASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54980.1 GT:GENE BAD54980.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(126032..126382) GB:FROM 126032 GB:TO 126382 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54980.1 LENGTH 116 SQ:AASEQ MAVSMSEDRFEELVSDALDLIPPELTGAIDNVVVLIEPRDPDDPHLLGLYRGIALTERDSHYGGALPDTVTIYRDAILEICADEAEVVEEVAVTVIHEIAHYFGIDEERLHQLGWG GT:EXON 1|1-116:0| PROS 94->103|PS00142|ZINC_PROTEASE|PDOC00129| SEG 79->100|eicadeaevveevavtviheia| BL:PDB:NREP 1 BL:PDB:REP 3->115|3e11A|2e-23|48.6|111/112| RP:PFM:NREP 1 RP:PFM:REP 30->114|PF06262|1e-09|37.6|85/87|DUF1025| HM:PFM:NREP 1 HM:PFM:REP 31->115|PF06262|1.1e-31|49.4|85/97|DUF1025| RP:SCP:NREP 1 RP:SCP:REP 3->115|3e11A1|3e-28|48.2|112/113|d.92.1.17| OP:NHOMO 70 OP:NHOMOORG 69 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-11--11111111-11112111--1111-1111111-11--111-1111111-111-11--1-1--------------------------------------------------------11111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 95.7 SQ:SECSTR ##ccccHHHHHHHHHHHHHTccGGGTGG#TTEEEEEEc#ccccTTccEEEEcccGGGcccTTcccccEEEEEEHHHHHHTcccHHHHHHHHHHHHHHHHHHHTTccHHHHHTTTc# DISOP:02AL 1-3| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHccEEEEEccccccccEEEEEEccEEccccccccccccccEEEEEHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHccc //