[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54981.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:384 amino acids
:PSIPRED
:DISOPRED
:TM
:REPEAT 2|105->224|234->346
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54981.1 GT:GENE BAD54981.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(126395..127549) GB:FROM 126395 GB:TO 127549 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54981.1 LENGTH 384 SQ:AASEQ MSSDDVSQDDVSQTPQQPRPGAGRPARARRSRAGSGNDSALARVREVRLSAPKLRWGLLAAAAGAVVAALVTLFVTGFENEKGLEAHNPAAPAHTVLDKEFGTASAGDCLTWSKPDRSDLMKVACDNRHLFEVAADIDMSRYPGVEFGPGSRFPDSLRLTELKEEHCVPAVQRYMNGKFDPRGRYVVGLMYPSPEGWKNGDRTLRCGLQFSASTGAPLPTTGSAATQDQSKVFAAGTCLGINQNLPTDPVDCAQEHAVEIVSTVDLGTHFTGGPPAKADQDKFVEEQCTTAVNDYLGSPDAIRNKTLTLFFDYVDARSWLAGSRKLDCMIGKGTDREGFAPIIGSARGDILINGQAPVPPPNSGRSTPTPLPGAAPLPPQPQPR GT:EXON 1|1-384:0| TM:NTM 1 TM:REGION 56->78| NREPEAT 1 REPEAT 2|105->224|234->346| SEG 2->36|ssddvsqddvsqtpqqprpgagrpararrsragsg| SEG 57->71|gllaaaagavvaalv| SEG 367->383|tptplpgaaplppqpqp| OP:NHOMO 38 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- -----11111111111111-11111111111111111111---1--------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-40, 83-89, 360-384| PSIPRED cccccccHHHHHHccccccccccccccccccccccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHEEEEccccccccccccccccccEEEEEccccccccccEEEccccccccEEEEccccccEEEEccccHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccHHHHHccccEEEEEEEcccccccEEEEEcccccccccEEEEcccEEccccccccccccccccccEEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHEEEEEEEEccccccccccccEEEEEEEEEccccccEEEEEEcccccEEEcccccccccccccccccccccccccccccccc //