[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54985.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:315 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->148 PF04657 * DUF606 3.7e-31 38.0 137/138  
:HMM:PFM   175->308 PF04657 * DUF606 5e-19 37.6 133/138  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54985.1 GT:GENE BAD54985.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 132459..133406 GB:FROM 132459 GB:TO 133406 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54985.1 LENGTH 315 SQ:AASEQ MRLGLVFGFCIGAGVAVQARINGALGMRLHDGIAAATVSFGTGLVVLAAAFAASGRLRAGLAAVRRALGEGQLRGWQLLGGLFGAFFVASQGLTVAAIGVTAFTVAAVAGQLLSSLAVDRAGLAPSGRTPVTPRRAGGAVLAIGAVVLATSTRTDAGQAGLALPESVREVPHPVLIALPALAGIGLAWQQAVNGRVGAVGGAGSAALVNFAVGFAVLLGVEFVVVLTLRGLGAFPTEPWLYLGGVIGVAFIALAALTVRWIGVLLLGLTSVAGQLVASVALDTLVPAGPGLSPWSLLGCLLTLVAIALATGPNRA GT:EXON 1|1-315:0| TM:NTM 9 TM:REGION 1->23| TM:REGION 33->54| TM:REGION 85->107| TM:REGION 136->152| TM:REGION 173->195| TM:REGION 206->228| TM:REGION 239->261| TM:REGION 265->287| TM:REGION 290->311| SEG 43->84|glvvlaaafaasgrlraglaavrralgegqlrgwqllgglfg| SEG 94->109|tvaaigvtaftvaava| SEG 136->149|aggavlaigavvla| SEG 175->187|lialpalagigla| SEG 191->208|avngrvgavggagsaalv| HM:PFM:NREP 2 HM:PFM:REP 4->148|PF04657|3.7e-31|38.0|137/138|DUF606| HM:PFM:REP 175->308|PF04657|5e-19|37.6|133/138|DUF606| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1---------------1-1-----11--11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 164-166, 313-315| PSIPRED cHHHHHHHHHHHHHHHHHHcccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccc //