[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54988.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  351/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:300 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   95->272 3fd3A PDBj 3e-29 40.8 %
:RPS:PDB   2->260 1b9nA PDBj 1e-18 15.5 %
:RPS:SCOP  1->106 1b9mA1  a.4.5.8 * 1e-15 18.9 %
:RPS:SCOP  103->256 1i69A  c.94.1.1 * 1e-06 15.6 %
:HMM:SCOP  4->114 1b9mA1 a.4.5.8 * 2.7e-22 40.4 %
:HMM:SCOP  80->301 1uthA_ c.94.1.1 * 2.4e-20 28.4 %
:RPS:PFM   6->64 PF00126 * HTH_1 4e-07 47.5 %
:HMM:PFM   6->64 PF00126 * HTH_1 1.3e-21 44.1 59/60  
:HMM:PFM   97->288 PF03466 * LysR_substrate 2.2e-16 23.4 188/209  
:BLT:SWISS 1->279 Y2007_MYCBO 6e-61 49.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54988.1 GT:GENE BAD54988.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 134534..135436 GB:FROM 134534 GB:TO 135436 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD54988.1 LENGTH 300 SQ:AASEQ MIDLPLDQVRTLLAVVDTGTFDAAAAALHVTPSAVSQRIKALEQRTGRVLVLRTKPVRPTESGQVLVRFARQLAALERDTQRELGIAAGSDATYLPIAVNADSLATWFLPALTRVPQDPPICFDLHREDESHTAMLLREGRVMAAVTSAAEPVPGCTARPLGAARYLPVASPAFAERHLRGEPGRRLPDAPVVVFDRRDELQDRFVRTLTAGRAAAGALRHHIPTSEGFCDAVTAGLGWGLIPEPQAAPLLRSGQLTTAVPGRWADVPLYWQQWKLDVPALALVAETIATAAAESLHPWR GT:EXON 1|1-300:0| BL:SWS:NREP 1 BL:SWS:REP 1->279|Y2007_MYCBO|6e-61|49.8|273/303| SEG 208->222|tltagraaagalrhh| SEG 280->294|alalvaetiataaae| BL:PDB:NREP 1 BL:PDB:REP 95->272|3fd3A|3e-29|40.8|174/202| RP:PDB:NREP 1 RP:PDB:REP 2->260|1b9nA|1e-18|15.5|239/258| RP:PFM:NREP 1 RP:PFM:REP 6->64|PF00126|4e-07|47.5|59/60|HTH_1| HM:PFM:NREP 2 HM:PFM:REP 6->64|PF00126|1.3e-21|44.1|59/60|HTH_1| HM:PFM:REP 97->288|PF03466|2.2e-16|23.4|188/209|LysR_substrate| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 1->106|1b9mA1|1e-15|18.9|106/122|a.4.5.8| RP:SCP:REP 103->256|1i69A|1e-06|15.6|147/206|c.94.1.1| HM:SCP:REP 4->114|1b9mA1|2.7e-22|40.4|104/0|a.4.5.8|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 80->301|1uthA_|2.4e-20|28.4|215/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 702 OP:NHOMOORG 355 OP:PATTERN -------------------------------------------------------------------- ----1111111---2--1--11---111111-11111211----11-211--223-22--1-1-31-222------------------------------------------------------------------111-1-----1--1----1----------------------------------------------1------------------------------2-----------------------------------------------------------------------------------------------------------------------------------------------1---------1---------1-11-11111-13------32-12--322224143411311--2231111121--------223--1-1----------------------------------1344369999885444477354444248642422--331313224222721-1-1--311111111111---211---11--1111-111-1-1------1----------------------------1121211-1---232222-12222222112121--11--------12131121111112111-1111111111111111111121442222222222222222222311111112-111111111111-------------11152222111-1111-2112222221---1277573444455553222---1--1---1--211111111113233333------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------1------------2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 272 STR:RPRED 90.7 SQ:SECSTR cEEEcHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHTcccEEEcccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccTTcHHHHHHHHTcccTTccEEEEEEcccccccccccccccEEEEEcTTcccEEEEEccHHHHHHTTccTTcEEEEEccGGGcEEEccHHHHHTccEEEEEEEEEEEccccEEEEEEHHHHHHTTccGGGcEcTTccEEEEEEEcGGGTTccTTcEEEEEEcGGGcEEEccTTcccEEEEEE############################ DISOP:02AL 83-91| PSIPRED cccccHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHcccEEEEEEEccccccccEEEEEccccEEEEEcHHHHHHccccccHHHHccccEEEEccccccHHHHHHHcccccEEEcccEEEEccHHHHHHHHHHcccHHHHHHHHHHHHHHcccEEEEcccccccEEEEccccccccHHHHHHHHHHHHHHHHHccccc //