[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD54994.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  192/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.1d.219.1
:428 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   86->204 1a04A PDBj 3e-08 33.6 %
:RPS:PDB   86->179 3cwoX PDBj 5e-12 19.4 %
:RPS:SCOP  86->162 1p2fA2  c.23.1.1 * 4e-13 28.9 %
:HMM:SCOP  37->208 1s8nA_ c.23.1.1 * 1.8e-26 29.2 %
:HMM:SCOP  197->421 1txoA_ d.219.1.1 * 0.00091 20.6 %
:RPS:PFM   86->155 PF00072 * Response_reg 7e-11 43.5 %
:RPS:PFM   227->395 PF07228 * SpoIIE 1e-07 34.8 %
:HMM:PFM   226->419 PF07228 * SpoIIE 1.9e-37 32.6 190/193  
:HMM:PFM   42->148 PF00072 * Response_reg 8.9e-19 33.3 105/112  
:BLT:SWISS 86->185 PHOB_RHIME 1e-09 34.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD54994.1 GT:GENE BAD54994.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 141751..143037 GB:FROM 141751 GB:TO 143037 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD54994.1 LENGTH 428 SQ:AASEQ MIGGRCRWIPAKWSAVAVRSDAFDADIGLAADAGWFEREPFVLLVEDDPGDALLVEELVADAAPGLRLEWVRTVAEAAERLRVAVPDCVLLDLHLPDAQGLEALARIRARNDQVAVVVMTGLDQERAGLAALASGAQDYLVKGRVEPELFARAVRYAIQRKQAERTSAALQASQMRAQENARLERGLLPTPLLGADAPVDVVARYRPGRAHSLLGGDFYDVVQDADGTVHAIIGDVSGHGPDAAATGVALRLAWRTLVLSGVTGSRQLRLLEQVLLAERTDRQTFATATSLLLDPATRRVRVRRAGHPGMLRYIDGEPHWVEVPGGAALGFLPGRAEWPDEEIELPEHAGLMLFTDGLFEGKVGRDGARLGEGGLLEVARAVPATRPEIFVDELIGRVEDLAADAGGLDDDLAIIYLRWHAAHGSDHR GT:EXON 1|1-428:0| BL:SWS:NREP 1 BL:SWS:REP 86->185|PHOB_RHIME|1e-09|34.3|99/227| SEG 51->63|dallveelvadaa| SEG 71->85|vrtvaeaaerlrvav| SEG 400->413|dlaadaggldddla| BL:PDB:NREP 1 BL:PDB:REP 86->204|1a04A|3e-08|33.6|116/205| RP:PDB:NREP 1 RP:PDB:REP 86->179|3cwoX|5e-12|19.4|93/236| RP:PFM:NREP 2 RP:PFM:REP 86->155|PF00072|7e-11|43.5|69/111|Response_reg| RP:PFM:REP 227->395|PF07228|1e-07|34.8|164/193|SpoIIE| HM:PFM:NREP 2 HM:PFM:REP 226->419|PF07228|1.9e-37|32.6|190/193|SpoIIE| HM:PFM:REP 42->148|PF00072|8.9e-19|33.3|105/112|Response_reg| GO:PFM:NREP 4 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0004721|"GO:phosphoprotein phosphatase activity"|PF07228|IPR010822| RP:SCP:NREP 1 RP:SCP:REP 86->162|1p2fA2|4e-13|28.9|76/120|c.23.1.1| HM:SCP:REP 37->208|1s8nA_|1.8e-26|29.2|168/190|c.23.1.1|1/1|CheY-like| HM:SCP:REP 197->421|1txoA_|0.00091|20.6|199/0|d.219.1.1|1/1|PP2C-like| OP:NHOMO 414 OP:NHOMOORG 198 OP:PATTERN ------------------------1------1------------1-2---11---------------- -44-B----------44----6--11-----134442-111748A1------111-----11--731QQH5-------1---1-----11---1------------1-----------------------------33311-----312511111-----1--22-13431---------------------1-11111111-111111------111-2-1-11------11-------------------------------------------------------------------------------------------------------------------1-----1--------------------1---------11-21--1--111------------------------------111-1--2------1-11---22222222-----6-1--------------------------------1---1-1--1-1---1111---11111-11------------------11-------1-1-------------1-231---2-33--1-23-2312------1312---------------------------------------1111---1--1----11----111-------------------------------------------------------------------------------------------------------3-----------------------------1111111111211211111----------------------------------------2177--11-------------------------------------1---------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 250 STR:RPRED 58.4 SQ:SECSTR ccEEEcccccEEEEccccccHHHHHHHHHHHHHHEEccccEEEEEcccHHHHHHHHHHHHHHcTTcEEEEEccHHHHHHHHHHTccccEEEEcccTTccHHHHHHHHHHHcccccEEEEccccTHHHHHHHHHTTccEEEEccHHHHHcTHHHHHHHHHHTGGGEEEEEEEEEccccEEHHHHHHHHccccccccccTTGGGEEHHHHHccccEEEEEccGGGTccE###EEEcHHHHTcccHHHHHHHHHHH############################################################################################################################################################################### DISOP:02AL 419-428| PSIPRED ccccHHHHHHHHcccccccccccccccccccccccccccccEEEEEccHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccccccEEEEEccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccEEEEEEEEEEccccEEEEEEccccccEEEccccEEEEEcccccEEEEccccccccEEEEEEccccEEEEEEccEEEcccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccEEEEEEEEccccccccc //