[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55001.1
DDBJ      :             putative transcription antitermination regulator
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.1d.110.3d.243.1
:236 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   41->130 3eehA PDBj 2e-06 22.2 %
:RPS:SCOP  42->137 1tfoA1  d.243.1.1 * 2e-07 6.6 %
:HMM:SCOP  26->130 1n9lA_ d.110.3.6 * 7.3e-12 33.0 %
:HMM:SCOP  145->196 1qo0D_ c.23.1.3 * 1e-05 32.7 %
:RPS:PFM   51->124 PF08447 * PAS_3 5e-05 40.5 %
:RPS:PFM   151->196 PF03861 * ANTAR 2e-05 43.5 %
:HMM:PFM   149->196 PF03861 * ANTAR 3.9e-18 37.5 48/56  
:HMM:PFM   40->124 PF08447 * PAS_3 1.4e-15 35.3 85/91  
:BLT:SWISS 60->179 Y1796_MYCLE 4e-18 37.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55001.1 GT:GENE BAD55001.1 GT:PRODUCT putative transcription antitermination regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 147579..148289 GB:FROM 147579 GB:TO 148289 GB:DIRECTION + GB:PRODUCT putative transcription antitermination regulator GB:PROTEIN_ID BAD55001.1 LENGTH 236 SQ:AASEQ MVIEGSRPSPQVIDALGSVIGTDSCSNAGEFRFHFADQRWEWSDEVARMHGYEPGEVQPTTELLLSHKHPEDREQVESALSRVETGEPFCSRHRIVDTAGEVHEVIVIGDYQTDEDGAVVGTTGYYIDLTDTIEGERKDVVDEVLPELVDARAPIEQAKGVLTVVYGISADQAFSVLRWRSQETNVKLRELAAQLVRDARGLDANRAGLRTRFDHVLLTVHERAGRPAGADGHRPR GT:EXON 1|1-236:0| BL:SWS:NREP 1 BL:SWS:REP 60->179|Y1796_MYCLE|4e-18|37.5|120/137| SEG 139->150|dvvdevlpelvd| RP:PDB:NREP 1 RP:PDB:REP 41->130|3eehA|2e-06|22.2|90/116| RP:PFM:NREP 2 RP:PFM:REP 51->124|PF08447|5e-05|40.5|74/90|PAS_3| RP:PFM:REP 151->196|PF03861|2e-05|43.5|46/56|ANTAR| HM:PFM:NREP 2 HM:PFM:REP 149->196|PF03861|3.9e-18|37.5|48/56|ANTAR| HM:PFM:REP 40->124|PF08447|1.4e-15|35.3|85/91|PAS_3| RP:SCP:NREP 1 RP:SCP:REP 42->137|1tfoA1|2e-07|6.6|91/103|d.243.1.1| HM:SCP:REP 26->130|1n9lA_|7.3e-12|33.0|103/109|d.110.3.6|1/1|PYP-like sensor domain (PAS domain)| HM:SCP:REP 145->196|1qo0D_|1e-05|32.7|52/0|c.23.1.3|1/1|CheY-like| OP:NHOMO 68 OP:NHOMOORG 37 OP:PATTERN ------------------------1-------------------------511--------------- --------------233----31121-----113334151-------------22-------2--------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------1-----------------------1---1----------------------------------------------------------------------------------------------------------------------------------------2---------1------------------------------------------------1----------------1----------1---------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 47.5 SQ:SECSTR #########################TcccccEEEcTTccEEEcTHHHHHHcccHHHHHHcGGGGGGGccHHHHHHHHHHHHHHHTTccEEEEEEEcGGGTTcEEEEEEEEEEEcTTccEEEEEEEEEEccHHHHHHH################################################################################################### DISOP:02AL 9-13, 229-236| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcccEEEEcHHHHHHHcccHHHHcccHHHHHHHccccHHHHHHHHHHHHHccccEEEEEEEEcccccEEEEEEEEEEEEcccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccEEEEcccEEEEEEEEccccccccccccc //