[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55003.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:308 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   182->232 PF05359 * DUF748 0.00016 24.5 49/150  
:BLT:SWISS 81->163 MIAB_BRASO 8e-05 34.9 %
:REPEAT 2|90->147|208->272
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55003.1 GT:GENE BAD55003.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(150608..151534) GB:FROM 150608 GB:TO 151534 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55003.1 LENGTH 308 SQ:AASEQ MNAATKFTGFAVGLAAIFGIALGVGALVGPTDSPPAEHAEHDTAADAPAADHLPGGLLVTDRGYTLELADPQVSAAPEVPLRLRILDASGAPVTRYTTSHDKDLHLIVVRRDLTAFQHVHPVLGADGTWSVPLNLSRAGDYRVYADFVPAAGENLTLGADLRVAGGYDPQPLPAPAGTAVVGDYTVTLTGTVTAGAPSTVTLSVARDGQPVTDLQPYLGAYGHLVALRSADLAYLHVHPEGHPGDGVTTPGPGITFAMTAPSPGDYRLFLDFQHEGVVRTAEFTVTVPRDGATATAPAPAPHDDGHGH GT:EXON 1|1-308:0| BL:SWS:NREP 1 BL:SWS:REP 81->163|MIAB_BRASO|8e-05|34.9|83/467| NREPEAT 1 REPEAT 2|90->147|208->272| SEG 34->52|ppaehaehdtaadapaadh| SEG 180->195|vvgdytvtltgtvtag| SEG 290->307|dgatatapapaphddghg| HM:PFM:NREP 1 HM:PFM:REP 182->232|PF05359|0.00016|24.5|49/150|DUF748| OP:NHOMO 33 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- --1-2---------1------2--11-----1-1112212---211------1-------------1-11---------------------------------------------------------------------11--------1----------------1-----------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 32-55, 299-308| PSIPRED ccccEEHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEcccccEEEEEccccccccccEEEEEEEEccccccccccccccEEEEEEEEEEcccccEEEEEEEEccccEEEEEEcccccccEEEEEEEEccccEEEEEEEEEEccccccccccccccccEEEccEEEEEccccccccccEEEEEEEEcccEEccccHHHccEEEEEEEEcccEEEEEEcccccccccccccccEEEEEEEccccccEEEEEEEEEccEEEEEEEEEEEccccccccccccccccccccc //