Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55004.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:218 amino acids
:HMM:PFM   54->177 PF04116 * FA_hydroxylase 1.2e-14 29.7 111/114  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55004.1 GT:GENE BAD55004.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(151587..152243) GB:FROM 151587 GB:TO 152243 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55004.1 LENGTH 218 SQ:AASEQ MTRSTVRRGMTLGDAFREFLRHPSPWMIATTLVCVLAARLAVGDWQPTDALVPLVMVAVFPVFEWVVHVLVLHWRPKRLGRLTLDSELARKHREHHIDPREIPLIFIPTRSLVIVLVALLLIAAFAFPRPGLGLTFLLTVTVLGLGYEWTHYLIHTDYKPRRALYRAVWRNHRHHHYKNEHYWFTVTSSGTADRLFGTCPDPATVATSPTARNLHGAH GT:EXON 1|1-218:0| TM:NTM 4 TM:REGION 23->45| TM:REGION 51->73| TM:REGION 102->124| TM:REGION 129->151| SEG 112->127|lvivlvallliaafaf| SEG 131->146|glgltflltvtvlglg| HM:PFM:NREP 1 HM:PFM:REP 54->177|PF04116|1.2e-14|29.7|111/114|FA_hydroxylase| OP:NHOMO 35 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- ----1---------1----------1------11111111-111------------------1-----------------------------------------------------------------------------------------------------------------------------------11111111-111111------111-------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 212-218| PSIPRED ccHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccEEEcccccccccccccccHHHHHccccccccccc //