[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55006.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:250 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   47->117 PF07810 * TMC 0.00025 22.7 66/111  
:HMM:PFM   185->244 PF00487 * FA_desaturase 0.00061 34.5 58/257  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55006.1 GT:GENE BAD55006.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(153152..153904) GB:FROM 153152 GB:TO 153904 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55006.1 LENGTH 250 SQ:AASEQ MSSGPGDRFRPLVYPGAVTVGALAVCAVLLPLADADQLAALATVMLVIVGYSGVRAARALGVVSTGVPAGERLSARRVRQQHRLVSRSWLEIAAGDRRWWVPVYFAPELVGLTVAEVHCAQAGSEGRSRLPFAGNRLSLREFETGAAGGAATGAVRLRVYPSGRARTSEPPGRLIDNPVRAAPDADERARVAARVPRRLLLDAQPAVAAPVAALLWVYLDGGGLPAFTGALVVGAAAAVWLTAVRGSDPS GT:EXON 1|1-250:0| TM:NTM 4 TM:REGION 12->34| TM:REGION 45->67| TM:REGION 200->221| TM:REGION 224->246| SEG 17->42|avtvgalavcavllpladadqlaala| SEG 144->154|tgaaggaatga| SEG 178->219|pvraapdaderarvaarvprrllldaqpavaapvaallwvyl| SEG 226->244|aftgalvvgaaaavwltav| HM:PFM:NREP 2 HM:PFM:REP 47->117|PF07810|0.00025|22.7|66/111|TMC| HM:PFM:REP 185->244|PF00487|0.00061|34.5|58/257|FA_desaturase| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 164-172, 247-250| PSIPRED cccccccccccEEEccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccHHHHHHHHHHHHHHcccccccccccccccccHHHccccccccccccEEEEEEEcccccccccccccHHccccccccccHHHHHHHHHccHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccc //