[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55015.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  146/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.181.1a.6.1
:257 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->111 1r8dB PDBj 4e-07 26.2 %
:BLT:PDB   182->248 1ny9A PDBj 3e-07 43.1 %
:RPS:PDB   10->242 3d70A PDBj 5e-16 11.0 %
:RPS:SCOP  9->111 1jbgA  a.6.1.3 * 1e-11 26.2 %
:RPS:SCOP  154->255 1ny9A  a.181.1.1 * 2e-06 29.3 %
:HMM:SCOP  10->112 1q06A_ a.6.1.3 * 3.4e-22 35.0 %
:HMM:SCOP  162->255 1ny9A_ a.181.1.1 * 1.8e-26 37.1 %
:RPS:PFM   11->48 PF00376 * MerR 6e-04 48.6 %
:RPS:PFM   133->251 PF07739 * TipAS 3e-14 38.8 %
:HMM:PFM   130->252 PF07739 * TipAS 2.3e-40 38.3 120/122  
:HMM:PFM   11->48 PF00376 * MerR 3.1e-15 42.1 38/38  
:HMM:PFM   55->106 PF09278 * MerR-DNA-bind 2.9e-05 32.7 52/65  
:BLT:SWISS 9->253 MTA_BACSU 1e-21 30.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55015.1 GT:GENE BAD55015.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 166166..166939 GB:FROM 166166 GB:TO 166939 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD55015.1 LENGTH 257 SQ:AASEQ MSSGTRTGEWSIQDLARAAGTTSRTLRHYGQLGLLPPSRIGANGYRYYDQDSLLRLQRILLLRELGLGLPVIAEVLAGEQDTAAALRTHLDLLTQEQDRIRRLIESVRTTLQKTERGEQLVAAEVFDGFDHSQYKDEVIERWGKDAYDRGDKWWRSLSEEQKKEFGQTHLDIAADYGRAHAAGLPVDSDEVQAIAARHRDWIALGWQGKPVTADAFVNLGEMYVADPRFAANYDVHGEGTAAYVRDAMKVYAEANLR GT:EXON 1|1-257:0| BL:SWS:NREP 1 BL:SWS:REP 9->253|MTA_BACSU|1e-21|30.0|237/257| SEG 53->69|llrlqrilllrelglgl| BL:PDB:NREP 2 BL:PDB:REP 9->111|1r8dB|4e-07|26.2|103/107| BL:PDB:REP 182->248|1ny9A|3e-07|43.1|65/94| RP:PDB:NREP 1 RP:PDB:REP 10->242|3d70A|5e-16|11.0|228/276| RP:PFM:NREP 2 RP:PFM:REP 11->48|PF00376|6e-04|48.6|37/37|MerR| RP:PFM:REP 133->251|PF07739|3e-14|38.8|116/121|TipAS| HM:PFM:NREP 3 HM:PFM:REP 130->252|PF07739|2.3e-40|38.3|120/122|TipAS| HM:PFM:REP 11->48|PF00376|3.1e-15|42.1|38/38|MerR| HM:PFM:REP 55->106|PF09278|2.9e-05|32.7|52/65|MerR-DNA-bind| GO:PFM:NREP 5 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00376|IPR000551| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00376|IPR000551| GO:PFM GO:0003677|"GO:DNA binding"|PF07739|IPR012925| GO:PFM GO:0016481|"GO:negative regulation of transcription"|PF07739|IPR012925| GO:PFM GO:0030528|"GO:transcription regulator activity"|PF07739|IPR012925| RP:SCP:NREP 2 RP:SCP:REP 9->111|1jbgA|1e-11|26.2|103/106|a.6.1.3| RP:SCP:REP 154->255|1ny9A|2e-06|29.3|92/94|a.181.1.1| HM:SCP:REP 10->112|1q06A_|3.4e-22|35.0|103/127|a.6.1.3|1/1|Putative DNA-binding domain| HM:SCP:REP 162->255|1ny9A_|1.8e-26|37.1|89/94|a.181.1.1|1/1|Antibiotic binding domain of TipA-like multidrug resistance regulators| OP:NHOMO 161 OP:NHOMOORG 147 OP:PATTERN -------------------------------------------------------------------- ----11111111---------1--11-----111111111----1111----111--1--11--1-1112---------11-------------------------1--1----------------------------------------------------------------------------------111111112111111112122-1111-1111-111111121---------------1---11---11---------11-----1---222111111111-11--1-11-------------111---111--1212111111111-1111-11-111--1----221------------------11-------------------------------------------------------------1-----------------------------------------------------------------1111-----------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------1211-------------------------------------------------------------------------------------------------------------------------------------------------- -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 240 STR:RPRED 93.4 SQ:SECSTR ########cEEHHHHHHHHTccHHHHHHHHHTTccccEEcTTTccEEEcGGGGGHHHHHHHHHHHTccHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccccEEEEEEccEEEEEEEcTTccTTTccGGGGHHHHHHHHHHHccccccEEEEEcccccccGGGccccEEEEEcccccTccTTccTTccTTcEEEEEccEEEEEEEEEccHHHHHHHHHHcEEEHH######### DISOP:02AL 1-10| PSIPRED cccccccccccHHHHHHHHcccHHHHHHHHHHcccccccccccccEEccHHHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHccccHHHHHHHHHHHHHHHHHccc //