[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55016.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:178 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   77->145 PF04622 * ERG2_Sigma1R 0.00023 33.8 65/216  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55016.1 GT:GENE BAD55016.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 167050..167586 GB:FROM 167050 GB:TO 167586 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55016.1 LENGTH 178 SQ:AASEQ MSAPEVRAGSATTASVTATVSAGLAAVGAAANVLGLLILGASFVSDPGRYDNSLAVATALGAALLAVALGYGALQMLRRADEGRWMVLLASGAWLAFAALGLLAALTGYRSDYGIRWSAEGGTGVDIATATTGLPGVVTAFVHGDWLPCLVGSVVPLAIAAVAAVPATARWFATAPTS GT:EXON 1|1-178:0| TM:NTM 4 TM:REGION 17->39| TM:REGION 54->76| TM:REGION 85->107| TM:REGION 137->159| SEG 8->41|agsattasvtatvsaglaavgaaanvlgllilga| SEG 54->74|lavatalgaallavalgygal| SEG 88->106|llasgawlafaalgllaal| SEG 154->175|vvplaiaavaavpatarwfata| HM:PFM:NREP 1 HM:PFM:REP 77->145|PF04622|0.00023|33.8|65/216|ERG2_Sigma1R| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 177-178| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHHHcccccccEEEEccccccEEEEEccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHEEEEcccc //