[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55027.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:176 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   88->175 PF05305 * DUF732 1.7e-10 37.3 75/100  
:HMM:PFM   25->105 PF05642 * Sporozoite_P67 0.00081 26.0 77/727  
:BLT:SWISS 97->175 Y1302_MYCBO 2e-05 34.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55027.1 GT:GENE BAD55027.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 181571..182101 GB:FROM 181571 GB:TO 182101 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55027.1 LENGTH 176 SQ:AASEQ MHRIRGKVAGLALAIAATGLLAACGDDDSTASSTPTLTTGATATSAAAASSSPAEGAPQSQAPAPEAPPSETVAPERPQPVPTEAVPPADTSGLSEKDKAFIAALEEKGVTPSSPDIALSIGSYVCQSVQAGASEQDLTTFVNAMAGADASFDPAKMPVEQAGRIYIDTAKQTYCQ GT:EXON 1|1-176:0| BL:SWS:NREP 1 BL:SWS:REP 97->175|Y1302_MYCBO|2e-05|34.8|69/113| SEG 9->23|aglalaiaatgllaa| SEG 29->76|stasstptlttgatatsaaaassspaegapqsqapapeappsetvape| HM:PFM:NREP 2 HM:PFM:REP 88->175|PF05305|1.7e-10|37.3|75/100|DUF732| HM:PFM:REP 25->105|PF05642|0.00081|26.0|77/727|Sporozoite_P67| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 32-98| PSIPRED ccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHccccccccHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccHHHcccEEEccccHHccc //