[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55033.1
DDBJ      :             putative peptidyl-prolyl cis-trans isomerase
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  668/915 : Eukaryota  190/199 : Viruses  0/175   --->[See Alignment]
b.62.1
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->165 2nulA PDBj 5e-62 67.9 %
:RPS:PDB   3->162 1clhA PDBj 2e-40 63.1 %
:RPS:SCOP  6->162 1a33A  b.62.1.1 * 2e-28 35.9 %
:HMM:SCOP  3->164 1lopA_ b.62.1.1 * 4.8e-58 45.1 %
:RPS:PFM   4->161 PF00160 * Pro_isomerase 1e-25 46.2 %
:HMM:PFM   4->162 PF00160 * Pro_isomerase 1.2e-46 45.5 145/155  
:BLT:SWISS 1->164 PPIB_STRAT 1e-66 72.0 %
:PROS 38->55|PS00170|CSA_PPIASE_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55033.1 GT:GENE BAD55033.1 GT:PRODUCT putative peptidyl-prolyl cis-trans isomerase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(193469..193966) GB:FROM 193469 GB:TO 193966 GB:DIRECTION - GB:PRODUCT putative peptidyl-prolyl cis-trans isomerase GB:PROTEIN_ID BAD55033.1 LENGTH 165 SQ:AASEQ MTKVNLETNFGPIVLELDDAKAPETVRNFVDYVNSGHYNGTIFHRVIPGFMIQGGGFEPGMRQKGTKAPIQNEAANGLKNDKYTVAMARTNDPHSATAQFFINVADNAFLNHTAPSPSGWGYAVFGQVVDGTDVVDKIAGVSTGSAGMHQDVPVDDVIITSASLA GT:EXON 1|1-165:0| BL:SWS:NREP 1 BL:SWS:REP 1->164|PPIB_STRAT|1e-66|72.0|164/166| PROS 38->55|PS00170|CSA_PPIASE_1|PDOC00154| BL:PDB:NREP 1 BL:PDB:REP 4->165|2nulA|5e-62|67.9|162/163| RP:PDB:NREP 1 RP:PDB:REP 3->162|1clhA|2e-40|63.1|157/166| RP:PFM:NREP 1 RP:PFM:REP 4->161|PF00160|1e-25|46.2|145/151|Pro_isomerase| HM:PFM:NREP 1 HM:PFM:REP 4->162|PF00160|1.2e-46|45.5|145/155|Pro_isomerase| GO:PFM:NREP 2 GO:PFM GO:0003755|"GO:peptidyl-prolyl cis-trans isomerase activity"|PF00160|IPR002130| GO:PFM GO:0006457|"GO:protein folding"|PF00160|IPR002130| RP:SCP:NREP 1 RP:SCP:REP 6->162|1a33A|2e-28|35.9|145/174|b.62.1.1| HM:SCP:REP 3->164|1lopA_|4.8e-58|45.1|162/164|b.62.1.1|1/1|Cyclophilin-like| OP:NHOMO 2144 OP:NHOMOORG 881 OP:PATTERN ----------------------------1-1-111---222212211111111--------1----22 114-11--1111111--12-11---111111-11111---12221111----112-11--1111221121--------2111---1-------------11322311122--------------111111211222222221112-1--222111--2211111--3--121-1211111211333-----11----------------1---------1111--------23-11111111111111111112111111111111111111122122222212222212222222222212222222222222221112222-211211111112122111122221111221211111-1----------14-2433322222222222222222222222222222-22222222222-2222222222222211121222222221111111111111221-----------------------------123422111112222222222222222222222222222222222222222222222223222222222222222221221-1322122222222122222331332121-------------------11--111222223324324444433444443444434--211-1------22222222222222122-2222222222222222222222222222222222222222222222222222-222222222222---2-----22221221211111211111111222222121112322222222222222222---------233332222233322111111111111112112111111----------2------------------------------------22 3-11334-513145545356334536433343433335323332223234333323534232334-1122-131222212-3342434-6A65745A98572354413F397AB7A33221332A7-32DR8155521225135533-143-251865655A76462746497651755*85564D779576789675D ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 165 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEcccEEEEEEccTTcHHHHHHHHHHHTcccGGGcccccEETTTEEccccccTTcccccccccccccccccccccTTcEEEccccccccccccEEEccccccTTccccccTccccccccEEEcccHHHHHHHTTccccccccccccccccccEEEEEEc DISOP:02AL 145-146| PSIPRED ccEEEEEEcccEEEEEEccccccHHHHHHHHHHccccccccEEEEEEccEEEEEccccccccccccccccccccccccccccEEEEEEccccccccccEEEEEEcccccccccccccccccEEEEEEEEccHHHHHHHHcccccccccccccccccEEEEEEEEc //